PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_34534
Common NameKK1_033944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 192aa    MW: 21473.8 Da    PI: 10.0122
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_34534genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF528.7e-171964247
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    ++ k +r+ tf+kR++g++ K  ELS LCd++ a+ii+s+++ ly
  C.cajan_34534 19 EVKQKNKRHATFCKRKQGLFNKLTELSLLCDVKTALIIISPSDMLY 64
                   678999************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.2451070IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-151069IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-191183IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-121232IPR002100Transcription factor, MADS-box
PfamPF003192.7E-162165IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-123247IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-124768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MASGGTTSSR KRRSTEIKEV KQKNKRHATF CKRKQGLFNK LTELSLLCDV KTALIIISPS  60
DMLYSCGYPD ADAVLRRYLG VGGSLQRNHC VKTHARVKCE SLRVEYEATQ NLLKAETKRL  120
QAMTKAQTDS CFDPWWNLPT EGMSLESLQT FKASLESLKL NLVAAVQEKQ LFTSVSPTSH  180
VLVPPPQLPN MS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1813SRKRRS
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_34534
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237602.11e-136agamous-like MADS-box protein AGL62
TrEMBLA0A151RPU21e-141A0A151RPU2_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA07G05001.18e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132271027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.17e-20AGAMOUS-like 61