PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32873
Common NameKK1_036159
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GATA
Protein Properties Length: 307aa    MW: 33608.4 Da    PI: 4.999
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32873genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68.2e-19224257134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  C.cajan_32873 224 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 257
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.4E-821306IPR016679Transcription factor, GATA, plant
SMARTSM004012.1E-14218272IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-14221281No hitNo description
PROSITE profilePS5011411.174222254IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-14222255IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.11E-14223280No hitNo description
PROSITE patternPS003440224249IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16224257IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEVAAAKALK PSLRTESVFS QAICDDILCF NANNIVVGED FSVDDLLDFS KEIDNYENEE  60
DEEKDSTSGS SQSQDPTEDD SNSNSTAGGG DDSVFAGELS VPADDVADLE WVSHFVDDSL  120
PELSLLYPVR SEQTRKWAEP EPTPVPDQAQ AQTPSAIPRK PRTGTIRKPN DRVLSFNASL  180
PPPFLCSSAL VGSVRGMVFG EPAAKKQKKR AEAQTGGAQF QRRCSHCQVQ KTPQWRTGPL  240
GPKTLCNACG VRFKSGRLFP EYRPACSPTF SGDIHSNSHR KVLEMRRRKE MAEPVTGSNR  300
TQLVPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-104AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492524.11e-154PREDICTED: GATA transcription factor 7-like
RefseqXP_014492528.11e-154PREDICTED: GATA transcription factor 7-like
TrEMBLA0A151RII00.0A0A151RII0_CAJCA; GATA transcription factor 12
STRINGGLYMA12G04180.21e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-49GATA transcription factor 7