PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32307
Common NameKK1_032304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Trihelix
Protein Properties Length: 276aa    MW: 33124.1 Da    PI: 9.1919
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32307genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.76.4e-281697186
       trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                   +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrergf+rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  C.cajan_32307 16 QWSQQETREFIAIRAELEKDFTASKRNKTLWEVVSSKMRERGFRRSPEQCKCKWKNLVNRYKGKETSDPEH----GRQCPFFEELH 97
                   7****************************************************************999986....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.3E-51375IPR001005SANT/Myb domain
CDDcd122031.15E-251580No hitNo description
PfamPF138373.4E-241598No hitNo description
PROSITE profilePS500907.6541773IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MSPAAAREER GPGQPQWSQQ ETREFIAIRA ELEKDFTASK RNKTLWEVVS SKMRERGFRR  60
SPEQCKCKWK NLVNRYKGKE TSDPEHGRQC PFFEELHAVF TQRAHNMQRL LLESETRSAQ  120
TKKGVKRSSV DRSSEELSED DDEVEYDSEE EKPSRSNTRK RKVDKVGMEK SSRANNPSNV  180
VSNSTSSIQE MLKEFFQHQL RMEMQWREMM ERRAQERQLF EQEWRQSMEK LERERLMIEQ  240
AWREREEQRR MREESRAERR DALLTTLLNK LINESN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-151787777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521444.11e-173PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A151RUB70.0A0A151RUB7_CAJCA; Zinc finger and SCAN domain-containing protein 29
STRINGGLYMA01G35370.21e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.18e-37Trihelix family protein