PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32168
Common NameKK1_034278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 308aa    MW: 33597.6 Da    PI: 7.3528
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32168genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.65.9e-09447441
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                   + C+ +++  ++l+C+ +  +lC  C ++ H        H +v+
  C.cajan_32168  4 KLCDSCKSATATLYCRPDAAFLCGACDSKVHAAnklasrHPRVT 47
                   68*****************************6567777787765 PP

2zf-B_box231.7e-074690341
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                    + C+ +e+ +++  C+ +   lC  C   +H+       H++ p
  C.cajan_32168 46 VTLCEVCEQAPAHVTCKADAAALCLACDRDIHSAnplasrHERLP 90
                   578*****************************6688888898876 PP

3CCT70.63.9e-24251294144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  C.cajan_32168 251 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 294
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.68148IPR000315B-box-type zinc finger
SMARTSM003367.5E-14148IPR000315B-box-type zinc finger
PfamPF006433.3E-7447IPR000315B-box-type zinc finger
CDDcd000213.60E-9548No hitNo description
PROSITE profilePS5011910.6084491IPR000315B-box-type zinc finger
PfamPF006433.8E-64691IPR000315B-box-type zinc finger
SMARTSM003365.5E-94991IPR000315B-box-type zinc finger
PfamPF062034.4E-18251293IPR010402CCT domain
PROSITE profilePS5101716.787251293IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRP DAAFLCGACD SKVHAANKLA SRHPRVTLCE VCEQAPAHVT  60
CKADAAALCL ACDRDIHSAN PLASRHERLP VTPFFESVHS VKASSPINFL DEHRFFSDAD  120
ADVSTEEAEA ASWLLPNPKT DLNSSPYLFS ESDPVPYIDL DYAAVDPKAE QKSSGTADGV  180
VPVQSNFEPF TYGYKFNSTL SQSQSQMSQS VSSSSMEVGV VPDGNTMSEI SNCSYSKVAV  240
TATAQFSAAD REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRTDADPLA  300
GYGVVPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0933000.0BT093300.1 Soybean clone JCVI-FLGm-17I7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502470.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-111COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A151RNV10.0A0A151RNV1_CAJCA; Zinc finger protein CONSTANS-LIKE 4
STRINGGLYMA04G06240.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-101CONSTANS-like 4