PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32032
Common NameKK1_033981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 259aa    MW: 29716.2 Da    PI: 6.3
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32032genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.57.4e-181050242
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   +i n+s r++t+ kR++g+lKK eELS+LC++e++ i++s+
  C.cajan_32032 10 FIVNDSARKTTYKKRKKGMLKKVEELSTLCGIEACAIVYSP 50
                   799*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.428149IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-25160IPR002100Transcription factor, MADS-box
CDDcd002662.32E-16285No hitNo description
SuperFamilySSF554551.28E-23294IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MTRKKVKLAF IVNDSARKTT YKKRKKGMLK KVEELSTLCG IEACAIVYSP FEREAEVWPS  60
DEGVQNVLGK FRSMPELEQS KKMVNQEGFI GQRILKSKEQ LMKLVKDNRE METTTFMFQC  120
LSVESVEPNN NTHVTDLNDL SSVIEVTLKE ISKRLETMNV NETTTTPNQS QLQAPSYQLQ  180
MPTQAYQSMQ TPTLSMPKSE EMTMMNFGHE LDTNANPMQR QFFMDLLNGN GRDEMIMHPP  240
SLVDADLRLQ TGFWPNMLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIVNDSARKTTYKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_32032
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237617.10.0agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-51AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A151RPS50.0A0A151RPS5_CAJCA; Agamous-like MADS-box protein AGL80
STRINGGLYMA18G05916.11e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-53AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]