PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32030
Common NameKK1_033979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 234aa    MW: 27323.4 Da    PI: 7.099
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32030genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF503.8e-161051243
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                   + +n+s+r++++ kR++ +lKK eE+++LC+++++ i+++ +
  C.cajan_32030 10 FLSNDSQRKTSYRKRKKSLLKKTEEICTLCGIDACAIVYGLD 51
                   579************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-17160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.016149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-20295IPR002100Transcription factor, MADS-box
CDDcd002663.58E-16285No hitNo description
PRINTSPR004049.9E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-121249IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MTRRKVKLAF LSNDSQRKTS YRKRKKSLLK KTEEICTLCG IDACAIVYGL DDPEPVIWPS  60
KSGVQNLLRR FRTLPEWEQT RKMVDQVSFI QQSITKEKEK MKKLVKENKD KEMTLLMYQC  120
LNEGRVVADN NMTTADFCVL SSVIDQNLRE ITRRLETLNI GEMTPHQPQI EPASNQPQMQ  180
PPAPEVAPTE EMSLLNYDRG LDMINANPLQ NEQWFMDFFN DNRDETTFWP NPFI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKVKLAFLSNDSQRKTSYRKRK
22125RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_32030
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237629.11e-175agamous-like MADS-box protein AGL80
TrEMBLA0A151RPQ51e-174A0A151RPQ5_CAJCA; Agamous-like MADS-box protein AGL80
STRINGGLYMA18G05976.19e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1823856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-33AGAMOUS-like 80