PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32028
Common NameKK1_033977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 247aa    MW: 28494.9 Da    PI: 8.7657
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32028genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.54.1e-141050242
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   +i n+  r+ t+ +R++gilKK eELS+ C++e + ii+++
  C.cajan_32028 10 FITNDAARKATYKQRKKGILKKIEELSTYCGIESCAIIYGP 50
                   799************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.918149IPR002100Transcription factor, MADS-box
SMARTSM004327.0E-13160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-19394IPR002100Transcription factor, MADS-box
CDDcd002661.81E-22385No hitNo description
PfamPF003191.2E-121050IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MPKTKVKLAF ITNDAARKAT YKQRKKGILK KIEELSTYCG IESCAIIYGP FVEAPEIWPS  60
ESGVQNVLGK FRTMTEWEQN RKMLDQEGFI EQNIVKGREK VKKLAKENKE KEMNMLMHQC  120
LKSGKIDPDN YMMATDFVNL SAVIDKKLKE INRKLETLNV NEMPPHQPKM QATTNHPHPQ  180
TEATSKQHQT QEPTQTVKPE EMTPLNYDQE PDLIPNPMQR QLLMENFIIG NEKETSLPPF  240
RDAKVPL
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_32028
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237628.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A151RPT10.0A0A151RPT1_CAJCA; Agamous-like MADS-box protein AGL80
STRINGGLYMA18G05916.17e-76(Glycine max)
STRINGGLYMA18G05976.15e-76(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.16e-39AGAMOUS-like 80