PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31872
Common NameKK1_034007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 416aa    MW: 46139.6 Da    PI: 5.0676
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31872genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.72.7e-091760340
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                   +r C+ +  k+++++C  ++ +lC+ C ++ H+       H++v
  C.cajan_31872 17 ARACDSCITKRARWYCAADDAFLCQACDSSVHSAnplarrHERV 60
                   578*****************************667888888876 PP

2CCT68.12.4e-23361404144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  C.cajan_31872 361 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 404
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.9071562IPR000315B-box-type zinc finger
SMARTSM003362.9E-101562IPR000315B-box-type zinc finger
PfamPF006435.9E-81760IPR000315B-box-type zinc finger
CDDcd000216.87E-91862No hitNo description
PfamPF062036.9E-18361403IPR010402CCT domain
PROSITE profilePS5101716.083361403IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MSSSAKNAAN AVGGKTARAC DSCITKRARW YCAADDAFLC QACDSSVHSA NPLARRHERV  60
RLKTASFKSG DEQQPPTWHT KKARTPRHGK HSPVSRNSNI NPFYLVPEVG SEEVNSQDEN  120
EEQLLYRVPI FDPLVAELCG TNSSASSATS TDEGGGGGAA AAAAAAAAAE VEKKGVESNV  180
FCHNNEMENL HGLLPSDAEL AEFAADVESL LGRGLENECV GMEVLGLVDA KEECWVKVEE  240
EEEEEEEEHG AVEMEMEMVG GRDESFELSF DYEMCEEVNE KEDEEEKRKK KKISLQLDYE  300
GVIIAWPSQK SPWTTAHRPN LDPDQCWHEC MGGCGTAVDN PYGEMGMGGF GIHPVIMDGG  360
REARVSRYRE KRRTRLFSKK IRYEVRKLNA EKRPRMKGRF VKRASFAPPT FPLLNK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371387RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_31872
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-67AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237646.20.0zinc finger protein CONSTANS-LIKE 16 isoform X2
TrEMBLA0A151RPK40.0A0A151RPK4_CAJCA; Zinc finger protein CONSTANS-LIKE 16
STRINGGLYMA10G42090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-90B-box type zinc finger protein with CCT domain