PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30984
Common NameKK1_033861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family SBP
Protein Properties Length: 903aa    MW: 100721 Da    PI: 8.3713
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30984genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-4085162178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  C.cajan_30984  85 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 162
                    6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-3480147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88983160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3784164IPR004333Transcription factor, SBP-box
PfamPF031107.9E-3086159IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.15E-5654789IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.5E-4694787IPR020683Ankyrin repeat-containing domain
CDDcd002043.50E-4697788No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MEKVAPPPIL MQRKRDLSYA VVPGNPTDNW KWDWDTVRFA GKPPPSDAVL EEESAPPPLQ  60
LNLGRASGGN KRLRSGSPGT ASYPMCQVDN CREDLSKAKD YHRRHKVCEA HSKASKALLA  120
NQMQRFCQQC SRFHPLSEFD EGKRSCRRRL AGHNRRRRKT QPEDVTSATP APAAANFEIF  180
NLLTAIAGAS QGKFEETRSQ VPDREQLVQI LNRIPLPADL ATKLLDAGNV NGKKDHVQLQ  240
TPSSYTRHDQ LNHMPSAPLT MDLLAVLSTT LSGSGPDATT SPSQNRSCTS DGGSDKSRTS  300
ADQTRQQQKY FSSDSSNPAE ERSPSSSPVG EMQIQQPSSL HSVPFQAGYT SSGSDHSPPS  360
LNSDAQDRTG RIMFKLFDKH PSHFPGTLRT QIYNWLSNRP SDMESYIRPG CVVLSIYASM  420
SSAAWEKLEE NFLQHVHSLI QNPDSDLWRN GRFLVHSGSQ MASHKDGKIR ICKSWRTWKS  480
PELISVSPLA IVSGQETSIS LKGRNLSTPG TKIHCTGTAS YTSAEVMESA YPGVMYDKIK  540
LGGFKVQDVS PGVLGRCFIE VENGFKGNSF PVIIADETIC KELKLLESEF DEEEKICDAI  600
SEEHEHQFGR PRSREEALHF LNELGWLFQR ERFSYVHEVP YYSLDRFKFV LTFSVERNCC  660
MLVKNLLDVL VDKHLQGDWL STGSVEMLNA IQLLNRAVKG KYKGMVDLLI HYSIPSKNGT  720
SKKYVFPPNL EGPGGITPLH LAACTSGSER IVDSLTSDPQ EIGLKCWESL VDTNGQTPHA  780
YAMMRNNDSY NVQVARKVAE RRRGEISVTI ENEIEQSSLR VELKKKQSNL IKRGQSSCAR  840
CAVAEIHYNR RVPGSQGLLH RPFIYSMLAV AAVCVCVCLF FRGRPFVGSV APFSWENLDY  900
GTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3276159184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_30984
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353300.0AC235330.1 Glycine max strain Williams 82 clone GM_WBb0082G12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237510.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A151RQ230.0A0A151RQ23_CAJCA; Squamosa promoter-binding-like protein 14
STRINGGLYMA20G00900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]