PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30318
Common NameKK1_029902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GATA
Protein Properties Length: 353aa    MW: 38706 Da    PI: 6.914
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30318genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18267301135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  C.cajan_30318 267 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 301
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-16261315IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.189261297IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.66E-14263323No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14265299IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.28E-14266314No hitNo description
PfamPF003202.0E-16267301IPR000679Zinc finger, GATA-type
PROSITE patternPS003440267292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MLYQTQHLPL FQFHPFTSST TPQLSTPPSS LTPLLLSQET ETEMECLEGA LKSSLRKDTA  60
LKVSPQTLLE ELAAPNVQNV VASCDDFFVD DLLDFSLLEK EEPDNHTHDS TSVSPKRHNH  120
EIHNNNHNHN PSFNDHFNSE LTVPAEDVAD LEWLSHFVED SFAEYSVSFP TVTVTESLSE  180
RAPEPGNTGF AFKTPVPAKA RSKRTRTGVR VWPLKSPSFT DTSSTLTSSS SSSSSSSPSS  240
PSRICEEKRA KKRAAADGGA AQAARRCSHC GVQKTPQWRT GPLGAKTLCN ACGVRYKSGR  300
LLPEYRPACS PTFSSELHSN HHRKVLEMRR KKEVVVEPDT GSGSGSATLV PGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156103.11e-136hypothetical protein PHAVU_003G258900g
SwissprotQ9FH572e-72GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A151S0V80.0A0A151S0V8_CAJCA; GATA transcription factor 14
STRINGGLYMA02G05710.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-47GATA transcription factor 7