PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_29495
Common NameKK1_031073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family ARR-B
Protein Properties Length: 530aa    MW: 58662 Da    PI: 5.266
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_29495genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.85e-28206259155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++F+ av+qL G+ekA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  C.cajan_29495 206 KPRVVWSVELHQQFMAAVNQL-GIEKAVPKRILELMNVPGLTRENVASHLQKYRL 259
                    79*******************.********************************8 PP

2Response_reg75.61.8e-25301381109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vdD+p+ +++l+++l+   y ev+ ++ +e al ll+e++  +D++l D+ mp+mdG++ll+ i  e  +lp+i+++a + ++ + + +  Ga
  C.cajan_29495  30 VLVVDDDPTCLMILERMLRACLY-EVTKCKRAEVALSLLRENKngFDIVLSDVHMPDMDGFKLLELIGLEM-DLPVIMMSADDGKSVVMKGVTHGA 123
                    89*****************9999.***************999999**********************6644.8*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +e+l +
  C.cajan_29495 124 CDYLIKPVRIEALKN 138
                    ***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.9E-1664510IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.1E-4127171No hitNo description
SuperFamilySSF521724.98E-3527148IPR011006CheY-like superfamily
SMARTSM004482.0E-2928140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.55829144IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.8E-2230138IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.34E-2831144No hitNo description
PROSITE profilePS5129410.154203262IPR017930Myb domain
SuperFamilySSF466891.24E-19203263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-29205264IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-24206259IPR006447Myb domain, plants
PfamPF002495.7E-7208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MNLSNGKGST SSSVKTGDTI SDQFPAGLRV LVVDDDPTCL MILERMLRAC LYEVTKCKRA  60
EVALSLLREN KNGFDIVLSD VHMPDMDGFK LLELIGLEMD LPVIMMSADD GKSVVMKGVT  120
HGACDYLIKP VRIEALKNIW QHVIRKRKNG AKDVEQSGSV EEGDRLQKGS EDGDYSSSVN  180
EGKSSKKRRD EEDEGEERDD SSTLKKPRVV WSVELHQQFM AAVNQLGIEK AVPKRILELM  240
NVPGLTRENV ASHLQKYRLY LRRLSGVSHQ QSSLNNSFMS SQEASFGATS ISGIDLQAFS  300
AASQLQSQSL AKLQAAGLGR STAKPGVPMP LSDQKNLFSF ESPRLRFGEG QMQHLSNNKP  360
MNLLHGIPTN MEPKQLVNLH QSSQSLGITS MPTKGMFHED GTSDIKGAGG FVPNYDMFNE  420
FNHQKSNDWD LTNTGMTYDA SQHANPLQGE GMHQGNLQNV GQPLNNLLVD NSLRVKDERI  480
PDQSTQINNM MSEQYGQEDL ISAFLKQQEG IGPVEDEFDF DGYSLDNIST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22205265464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_29495
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020235131.10.0two-component response regulator ARR2 isoform X1
RefseqXP_020235132.10.0two-component response regulator ARR2 isoform X2
SwissprotQ9ZWJ91e-172ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A151RXK90.0A0A151RXK9_CAJCA; Two-component response regulator
STRINGGLYMA15G15520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-151response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]