PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_29262
Common NameKK1_033126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 411aa    MW: 44814.2 Da    PI: 4.9252
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_29262genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.1e-05544639
       zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                   C+ +++++   +C+++  +lC +C  + H+       H++
  C.cajan_29262  5 CDFCGDQRSLVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                   *****************************65677777766 PP

2zf-B_box22.13.2e-074688441
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     C++++++++   C + +  lC++C   +H g      H++++
  C.cajan_29262 46 LLCERCNSQPAFVRCVEEKISLCQNCDWLGH-GtspssaHKRQT 88
                   57*****************************.558889998876 PP

3CCT644.4e-22354397144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R +a++RYkeK+ktRkFeKk+rY+sRKa+A+ R+RvKGrFvk+ 
  C.cajan_29262 354 RSNAVMRYKEKKKTRKFEKKVRYASRKARADVRKRVKGRFVKAG 397
                    899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
CDDcd000213.55E-7447No hitNo description
SMARTSM003361.7E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.664389IPR000315B-box-type zinc finger
CDDcd000211.02E-44789No hitNo description
SMARTSM003361.44889IPR000315B-box-type zinc finger
PfamPF062038.5E-17354396IPR010402CCT domain
PROSITE profilePS5101715.467354396IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGYLCDFCGD QRSLVYCRSD AACLCLSCDR NVHSANALSR RHSRTLLCER CNSQPAFVRC  60
VEEKISLCQN CDWLGHGTSP SSAHKRQTIN CYNGCPSAAE FSSIWSFFLD IPSMGEACEQ  120
ELGLMSINEN SNKSAWVPPE GQNVSGSAQV ADLPSKDKSC AGTSSMPELS SEPRILDQPP  180
GPANECVPKL YCPGKKVSGI CEDDDLYDDF AMDEVDLELE HYEELFGMAL THSEELFENG  240
GIDSLFETKD MSASAGDSHC QGAVAAEGSS AGLVNAMQPA CSNAASADSM LSTKTEPIVC  300
FTARQSQSNI SFSGVTKDSA GDYQEDCGAS SMLLMGEPPW CPPCPESSLQ SANRSNAVMR  360
YKEKKKTRKF EKKVRYASRK ARADVRKRVK GRFVKAGEVY DYDPLSQTRS C
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_29262
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0688990.0HM068899.1 Glycine max CONSTANS-like zinc finger protein (COL18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020236809.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_020236813.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_020236814.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_020236815.10.0zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE51e-146COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A151RS060.0A0A151RS06_CAJCA; Zinc finger protein CONSTANS-LIKE 9
STRINGGLYMA14G36930.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-119CONSTANS-like 9