PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27731
Common NameKK1_031200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 125aa    MW: 14822.3 Da    PI: 10.2706
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27731genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.11.1e-25249552
         RWP-RK  5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                   +s +++s+yF++pi +AA+eL+v+lT LK++CR++GI+RWPhRk+ sl
  C.cajan_27731  2 LSRKTVSEYFYMPISQAARELNVGLTHLKKRCRELGIQRWPHRKLMSL 49
                   68899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53169IPR003035RWP-RK domain
PfamPF020422.5E-21249IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MLSRKTVSEY FYMPISQAAR ELNVGLTHLK KRCRELGIQR WPHRKLMSLQ TLIKKIQEQG  60
EGNENDEKIR AAIEVLEREK RMVEEMPDLQ LDDNTRKLRQ ACFKAKYKKR KLTGMHEVHE  120
TTISP
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_27731
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020235220.15e-82protein RKD1
SwissprotQ9M9U93e-49RKD1_ARATH; Protein RKD1
TrEMBLA0A151RXA11e-87A0A151RXA1_CAJCA; Uncharacterized protein
STRINGGLYMA04G33516.11e-66(Glycine max)
STRINGGLYMA06G20881.12e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-51RWP-RK domain-containing protein