PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27701
Common NameKK1_027748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRAS
Protein Properties Length: 507aa    MW: 56240.6 Da    PI: 4.7298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27701genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2378.4e-731144952374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                    ++lL  cA a++ g+ +++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s++++  + + + +s ++     ++l  f+evsP++ f + +
  C.cajan_27701 114 EQLLNPCAAAITGGNVNRVQHLLYVLHELASPTGDANHRLAAHGLKALTQHLSSSTTSVTTSGSITFAS-TEPRFFQKSLLKFYEVSPWFSFPNNI 208
                    689***************************************************888888777666665.344555555556************** PP

           GRAS  98 aNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg............skeeleetgerLakfAeelgvpf 176
                    aN  Il+ + ++    +++Hi+ +++s+G+QWp+Ll+aL+ Rp ++pp +R+T+v +++++                  +  + L  fA+ ++v++
  C.cajan_27701 209 ANASILQVLGEDpnnsRTLHILEIGVSHGMQWPTLLEALSRRPgGPPPLVRLTVVTASSTEnndqnyidtpfsIGPPGDNFSSSLLGFAQFMNVNL 304
                    ********98877777999************************55566*******99887788888888777767778899999************ PP

           GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..n.sesFlerflealeyysalfd 269
                    ++n l   +l++l+ ++ +++p+E  +V+ +++lh+l    +++++er+e+Lk++++++Pk v+++++++++  n  ++F+++f++ +ey + ++d
  C.cajan_27701 305 QINRLDNCSLQTLNAQSVDTSPDEIFVVCAQFRLHQLN---HHTPDERSEFLKVLRNMEPKGVILSDNNMECccNcCGDFATGFSRRVEYLWRFLD 397
                    ****9777*****************************9...55555566********************9885431469***************** PP

           GRAS 270 sleakl.preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                    s++a + +res+er+++E      e+ +++++  a+    +e +ekW +r++e+GF    ++e+a +  ++llrk++ +++++ve+e++s+ l Wk
  C.cajan_27701 398 STSAAFkGRESDERRVME-----GEAAKALTNLRAM----NEGKEKWCARMKEVGFVGEVFGEDAIDGGRALLRKYDnNWEMKVEDENASVGLWWK 484
                    **6665145555555555.....5577777777776....88899********************************9999*************** PP

           GRAS 364 drpLvsvSaWr 374
                    ++p+ +++ W+
  C.cajan_27701 485 GQPVSFCTLWK 495
                    **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.37387474IPR005202Transcription factor GRAS
PfamPF035142.9E-70114495IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MIMEPNSTSD HTLDWFEGPV SFFPLPPFLD DPYNSSDIQE YQLWDEDITS HYQTDANTNS  60
PNATNIDTST PLEPCGSNNL PLSDLAKKRS ATDESSGAKG VGNNCNNKEG RWAEQLLNPC  120
AAAITGGNVN RVQHLLYVLH ELASPTGDAN HRLAAHGLKA LTQHLSSSTT SVTTSGSITF  180
ASTEPRFFQK SLLKFYEVSP WFSFPNNIAN ASILQVLGED PNNSRTLHIL EIGVSHGMQW  240
PTLLEALSRR PGGPPPLVRL TVVTASSTEN NDQNYIDTPF SIGPPGDNFS SSLLGFAQFM  300
NVNLQINRLD NCSLQTLNAQ SVDTSPDEIF VVCAQFRLHQ LNHHTPDERS EFLKVLRNME  360
PKGVILSDNN MECCCNCCGD FATGFSRRVE YLWRFLDSTS AAFKGRESDE RRVMEGEAAK  420
ALTNLRAMNE GKEKWCARMK EVGFVGEVFG EDAIDGGRAL LRKYDNNWEM KVEDENASVG  480
LWWKGQPVSF CTLWKLDGND QSSTFTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1614349533375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516188.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A151S6R50.0A0A151S6R5_CAJCA; Nodulation-signaling pathway 1 protein
STRINGGLYMA16G01020.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-152GRAS family protein