PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27701
Common NameKK1_027748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRAS
Protein Properties Length: 507aa    MW: 56240.6 Da    PI: 4.7298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27701genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2378.4e-731144952374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                    ++lL  cA a++ g+ +++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s++++  + + + +s ++     ++l  f+evsP++ f + +
  C.cajan_27701 114 EQLLNPCAAAITGGNVNRVQHLLYVLHELASPTGDANHRLAAHGLKALTQHLSSSTTSVTTSGSITFAS-TEPRFFQKSLLKFYEVSPWFSFPNNI 208
                    689***************************************************888888777666665.344555555556************** PP

           GRAS  98 aNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg............skeeleetgerLakfAeelgvpf 176
                    aN  Il+ + ++    +++Hi+ +++s+G+QWp+Ll+aL+ Rp ++pp +R+T+v +++++                  +  + L  fA+ ++v++
  C.cajan_27701 209 ANASILQVLGEDpnnsRTLHILEIGVSHGMQWPTLLEALSRRPgGPPPLVRLTVVTASSTEnndqnyidtpfsIGPPGDNFSSSLLGFAQFMNVNL 304
                    ********98877777999************************55566*******99887788888888777767778899999************ PP

           GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..n.sesFlerflealeyysalfd 269
                    ++n l   +l++l+ ++ +++p+E  +V+ +++lh+l    +++++er+e+Lk++++++Pk v+++++++++  n  ++F+++f++ +ey + ++d
  C.cajan_27701 305 QINRLDNCSLQTLNAQSVDTSPDEIFVVCAQFRLHQLN---HHTPDERSEFLKVLRNMEPKGVILSDNNMECccNcCGDFATGFSRRVEYLWRFLD 397
                    ****9777*****************************9...55555566********************9885431469***************** PP

           GRAS 270 sleakl.preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                    s++a + +res+er+++E      e+ +++++  a+    +e +ekW +r++e+GF    ++e+a +  ++llrk++ +++++ve+e++s+ l Wk
  C.cajan_27701 398 STSAAFkGRESDERRVME-----GEAAKALTNLRAM----NEGKEKWCARMKEVGFVGEVFGEDAIDGGRALLRKYDnNWEMKVEDENASVGLWWK 484
                    **6665145555555555.....5577777777776....88899********************************9999*************** PP

           GRAS 364 drpLvsvSaWr 374
                    ++p+ +++ W+
  C.cajan_27701 485 GQPVSFCTLWK 495
                    **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.37387474IPR005202Transcription factor GRAS
PfamPF035142.9E-70114495IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MIMEPNSTSD HTLDWFEGPV SFFPLPPFLD DPYNSSDIQE YQLWDEDITS HYQTDANTNS  60
PNATNIDTST PLEPCGSNNL PLSDLAKKRS ATDESSGAKG VGNNCNNKEG RWAEQLLNPC  120
AAAITGGNVN RVQHLLYVLH ELASPTGDAN HRLAAHGLKA LTQHLSSSTT SVTTSGSITF  180
ASTEPRFFQK SLLKFYEVSP WFSFPNNIAN ASILQVLGED PNNSRTLHIL EIGVSHGMQW  240
PTLLEALSRR PGGPPPLVRL TVVTASSTEN NDQNYIDTPF SIGPPGDNFS SSLLGFAQFM  300
NVNLQINRLD NCSLQTLNAQ SVDTSPDEIF VVCAQFRLHQ LNHHTPDERS EFLKVLRNME  360
PKGVILSDNN MECCCNCCGD FATGFSRRVE YLWRFLDSTS AAFKGRESDE RRVMEGEAAK  420
ALTNLRAMNE GKEKWCARMK EVGFVGEVFG EDAIDGGRAL LRKYDNNWEM KVEDENASVG  480
LWWKGQPVSF CTLWKLDGND QSSTFTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B4e-4111049530419Protein SHORT-ROOT
5b3h_E4e-4111049530419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_27701
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020232189.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A151S6R50.0A0A151S6R5_CAJCA; Nodulation-signaling pathway 1 protein
STRINGXP_007135437.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-152GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]