PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26913
Common NameKK1_028749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family SBP
Protein Properties Length: 508aa    MW: 55470.6 Da    PI: 6.5037
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26913genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.3e-42177252277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  C.cajan_26913 177 CQVYGCNKDLSGCKDYHKRHKVCEVHSKTSKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 252
                    **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.9E-33171238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.445174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-39175255IPR004333Transcription factor, SBP-box
PfamPF031106.5E-31177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MESWSFVGEE KGYVSNGALS SPNTLGRSKG SFLGWELKTP CSFSNDMLAL GQQNVQDQGF  60
EELGFPGMLG NKQLFGDPIR KVDDVVVDCR VTSPSPVVAA PNAFSARGDF NSKLSNSLGD  120
SNGANSLIDL KLGRFGDHGD AMVPTFSKGA PTLSSSESST PQKRVRASGV HSQTAYCQVY  180
GCNKDLSGCK DYHKRHKVCE VHSKTSKVIV NGIEQRFCQQ CSRFHLLVEF DDGKRSCRKR  240
LAGHNERRRK PQVGIHSGKA GRLLQPYSDS RFQETMLTSS FICQEILPSG VLSSEKYGAS  300
NWWRPIEAED TNGFTFKPLS SIPITNGHPQ SRSLFPSYTE KQVQFLNKNN NQYHHPPSLG  360
GQNSGSQLVF HDTCLGSEDL NVFDTELSGI SDSGCALSLL SSQSQNSSSH RHYSMSEVSE  420
KMMGISSQDS SGVSDKFPSA DGTPLDLSHP ILISDSNEIV NFEMAEGIFQ GCTEDGLTID  480
LLQLSSRNVT MQLHGGTTPP LSSRDDYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291772501184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_26913
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020233061.10.0squamosa promoter-binding-like protein 6
RefseqXP_029130209.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A151S4110.0A0A151S411_CAJCA; Squamosa promoter-binding-like protein 6
STRINGGLYMA04G32002.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-52SBP family protein