PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26721
Common NameKK1_030262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 370aa    MW: 41109.7 Da    PI: 4.7791
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26721genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-061858438
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                   r+C+++ + + +l+C+ ++ +lC +C    H        H+
  C.cajan_26721 18 RVCDTCRSAPCTLYCHADSAYLCSSCDARVHAAnrvasrHE 58
                   68*************************99995555666665 PP

2zf-B_box28.63e-0960105342
       zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                     ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  C.cajan_26721  60 VWVCEACERAPAAFLCKADAASLCSSCDADIHSAnvlasrHHRVPI 105
                    689*****************************66899999877775 PP

3CCT69.21e-23300343144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eK+ktRkFeKkirY+sRKa+Ae+RpR+KGrF+k++
  C.cajan_26721 300 REARVLRYREKKKTRKFEKKIRYASRKAYAETRPRIKGRFAKRT 343
                    9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.5661562IPR000315B-box-type zinc finger
SMARTSM003362.8E-81562IPR000315B-box-type zinc finger
CDDcd000217.94E-81862No hitNo description
PROSITE profilePS5011910.86558105IPR000315B-box-type zinc finger
PfamPF006432.9E-759105IPR000315B-box-type zinc finger
CDDcd000211.39E-761105No hitNo description
SMARTSM003368.3E-763105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.827300342IPR010402CCT domain
PfamPF062038.3E-18300342IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MLKEGTNNVG GSTSSWSRVC DTCRSAPCTL YCHADSAYLC SSCDARVHAA NRVASRHERV  60
WVCEACERAP AAFLCKADAA SLCSSCDADI HSANVLASRH HRVPILPISG SLLFVDHEPD  120
HEPDNNVGFA SVREVEEEEE EVFDEYEDEV EAASWLLPHP VKVSIEEENG CDDEGFLFGD  180
EYLDFDLVDC NSCAHNNTFS NVYQNQQNYN TLPQNYAVVP VQVPQQSQCF QPGLDFDSSK  240
AGFSYDGSLS QSVSVSSMDV GVVPESTVSE ISMSHSKSSI GTCDLFPPLP LPSHLIPMDR  300
EARVLRYREK KKTRKFEKKI RYASRKAYAE TRPRIKGRFA KRTNNVEAEV DQMLSTTLFT  360
EVGGSIFPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509740.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-116COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A151S0050.0A0A151S005_CAJCA; Zinc finger protein CONSTANS-LIKE 2
STRINGGLYMA13G07030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-66CONSTANS-like 2