PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26683
Common NameKK1_028628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 192aa    MW: 22409.6 Da    PI: 9.207
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26683genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.72.3e-161863449
                   -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   ++++   +tfskR+ gi KKA+ELS+LC+a+v +++f s+g+ + y
  C.cajan_26683 18 KSNRDLLITFSKRKYGIHKKASELSTLCGAKVDILMFTSSGNWFSY 63
                   44455568*********************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.413767IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-18782IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-15766IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-12929IPR002100Transcription factor, MADS-box
PfamPF003194.1E-161763IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MDGREMKGKQ KRENKKVKSN RDLLITFSKR KYGIHKKASE LSTLCGAKVD ILMFTSSGNW  60
FSYGEPSHQA MARSSDEESP IELVEVHTKS EINELNAKNN ALMSQIYYEK KREDELDAIL  120
KTKNPRGWWE PKIQDLSREQ AMETEASFVE FKKKLENELS IKHREKENNA SQGEALLFLL  180
LTCLYYLKKT YY
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_26683
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020232939.11e-122agamous-like MADS-box protein AGL23
TrEMBLA0A151S4C11e-139A0A151S4C1_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA08G08870.17e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1822966
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-23AGAMOUS-like 62