PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_24870
Common NameKK1_024968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 210aa    MW: 23545.7 Da    PI: 8.4056
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_24870genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.3e-2064118256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq   Lee F+++++++ ++++ LAk+l+Lt rqV vWFqNrRa+ k
  C.cajan_24870  64 RKKLRLTKEQSAMLEESFKQHSTLNPKQKQALAKQLSLTPRQVEVWFQNRRARTK 118
                    78889************************************************98 PP

2HD-ZIP_I/II126.21.5e-4064153191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rl+keq+++LEesF+++++L+p++K++la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  C.cajan_24870  64 RKKLRLTKEQSAMLEESFKQHSTLNPKQKQALAKQLSLTPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 153
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.96E-1953121IPR009057Homeodomain-like
PROSITE profilePS5007117.76760120IPR001356Homeobox domain
SMARTSM003894.6E-1762124IPR001356Homeobox domain
PfamPF000462.8E-1764118IPR001356Homeobox domain
CDDcd000862.52E-1764121No hitNo description
Gene3DG3DSA:1.10.10.609.7E-1964118IPR009057Homeodomain-like
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
SMARTSM003402.8E-25120163IPR003106Leucine zipper, homeobox-associated
PfamPF021833.5E-10120154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGHNNKVSCE DPLEQTSPHS AVSSFSSGRV KRERDLSCEE VDVTETERVS SRASDEEEDG  60
TTARKKLRLT KEQSAMLEES FKQHSTLNPK QKQALAKQLS LTPRQVEVWF QNRRARTKLK  120
QTEVDCEFLK KCCETLTDEN RRLQKELQEL KALKLAQPLY MPMPAATLTM CPSCERLGGG  180
VNGGASPKTP FSMAPKPHFF NPFANPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_24870
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311731e-175KT031173.1 Glycine max clone HN_CCL_18 homeodomain/HOMEOBOX transcription factor (Glyma17g16930.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020229605.11e-154homeobox-leucine zipper protein HAT22
SwissprotP466041e-85HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A151SEB91e-153A0A151SEB9_CAJCA; Homeobox-leucine zipper protein HAT22
STRINGXP_007155789.11e-134(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-76HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]