PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_23386
Common NameKK1_024072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 277aa    MW: 30867.8 Da    PI: 8.0383
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_23386genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-17116170256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  C.cajan_23386 116 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 170
                    778899***********************************************98 PP

2HD-ZIP_I/II127.55.6e-41116206192
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                    +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  C.cajan_23386 116 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 206
                    69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-17102170IPR009057Homeodomain-like
SuperFamilySSF466891.34E-18106173IPR009057Homeodomain-like
PROSITE profilePS5007117.151112172IPR001356Homeobox domain
SMARTSM003891.3E-15114176IPR001356Homeobox domain
CDDcd000861.16E-15116173No hitNo description
PfamPF000463.5E-15116170IPR001356Homeobox domain
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
SMARTSM003404.5E-26172215IPR003106Leucine zipper, homeobox-associated
PfamPF021835.2E-11172206IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MELALSLGDT SKSFTLPTKE ASGFCVAPSF TVGRGSEEKK SDDERRGSSD PPLQLDLLPF  60
TPVQRSQPPS QLRIPWLTQA CGAARVLDVN LFPAAAEDGD DGTSLVSDDE ENGSTRKKLR  120
LSKEQSAFLE ESFKEHTTLN PKQKLALAKQ LNLRPRQVEV WFQNRRARTK LKQTEVDCEY  180
LKRCCETLTE ENRRLQKELQ ELRALKTSQP FYMQLPATTL TMCPSCERVA TNSTTTNQTS  240
NINNGSQIPV ELSLSKPRIL PFPTGQAQAQ AHQIASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120TRKKLRL
2164172RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_23386
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150413e-95AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020215741.11e-177homeobox-leucine zipper protein HOX11
SwissprotP466653e-80HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A151TL050.0A0A151TL05_CAJCA; Homeobox-leucine zipper protein HAT14
STRINGGLYMA09G16790.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-66homeobox from Arabidopsis thaliana