PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_22364
Common NameKK1_023022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31926.4 Da    PI: 6.8411
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_22364genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-19124178256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq  +Lee F+++++++ ++++eLA kl+L +rqV vWFqNrRa+ k
  C.cajan_22364 124 RKKLRLTKEQSAILEENFREHSTLNPKQKQELAVKLNLRTRQVEVWFQNRRARTK 178
                    78889************************************************98 PP

2HD-ZIP_I/II120.87e-39124212189
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                    +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+E+d+e Lk+++d+l++en+rL+kev+eL++
  C.cajan_22364 124 RKKLRLTKEQSAILEENFREHSTLNPKQKQELAVKLNLRTRQVEVWFQNRRARTKLKQTESDCELLKKCCDTLTDENKRLQKEVQELKS 212
                    69*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.297120180IPR001356Homeobox domain
SuperFamilySSF466892.01E-18120181IPR009057Homeodomain-like
SMARTSM003898.1E-16122184IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-17122185IPR009057Homeodomain-like
CDDcd000865.19E-15123181No hitNo description
PfamPF000465.9E-17124178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
SMARTSM003402.5E-18180224IPR003106Leucine zipper, homeobox-associated
PfamPF021832.3E-10180213IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSFHNTGLGL GLGLGLVGFH DHQSENSIES HKKKVENPSK CNKEYPSLTL GPPDDDEVNN  60
QPSSKTESYE YFRPQVSSPS AVSSFSNSSS IKRERDQALG EEFEVEVEKV PTRVADVDED  120
GNPRKKLRLT KEQSAILEEN FREHSTLNPK QKQELAVKLN LRTRQVEVWF QNRRARTKLK  180
QTESDCELLK KCCDTLTDEN KRLQKEVQEL KSMQTRAVPL YMQIPAATLS ICPSCERMCS  240
GNNDNNDNDS SHTTTLFIGS NNHHNHFYKS SYPFSHSSSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_22364
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0994120.0BT099412.1 Soybean clone JCVI-FLGm-13F4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020222789.10.0homeobox-leucine zipper protein HAT9
SwissprotA2XE761e-62HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-62HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A151T0N90.0A0A151T0N9_CAJCA; Homeobox-leucine zipper protein HOX19
STRINGGLYMA14G10370.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-60HD-ZIP family protein