PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_22328
Common NameKK1_022986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family ARR-B
Protein Properties Length: 635aa    MW: 69301.5 Da    PI: 6.364
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_22328genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.5e-29211264155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  C.cajan_22328 211 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 264
                    79*******************.********************************8 PP

2Response_reg85.51.6e-28261341109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + +  Ga
  C.cajan_22328  26 VLAVDDDPICLKVLENLLRKCQY-QVTTTNQAAEALKMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKGVTHGA 119
                    799********************.***************999889*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  C.cajan_22328 120 CDYLLKPVRMEELKN 134
                    ************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.7E-1671631IPR017053Response regulator B-type, plant
SuperFamilySSF521721.85E-3723144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.3E-4523158No hitNo description
SMARTSM004481.1E-3524136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011045.80225140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.0E-2626134IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.02E-3127140No hitNo description
PROSITE profilePS5129412.009208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-30208268IPR009057Homeodomain-like
SuperFamilySSF466895.02E-20209268IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-25211264IPR006447Myb domain, plants
PfamPF002491.0E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MAVENQRGHL GNEDGGNDPF PVGMRVLAVD DDPICLKVLE NLLRKCQYQV TTTNQAAEAL  60
KMLRENRNKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMKGVTHGAC  120
DYLLKPVRME ELKNIWQHVI RRKNSDGKDQ NKSSNEEKAP NIAGEGSQGL RSENSADQNK  180
RLGKRRKDQS EDEEEDGEGN GDEEDPSAQK KPRVVWSVEL HRKFVAAVNQ LGLDKAVPKK  240
ILDLMNVEGL TRENVASHLQ KYRLYLKKAA QQANMVAALG GSDSYLRMGS IDGYGDFCTS  300
SGTGRISNST LPSYASSGIF SRLNSPAGLN MRGISSSALI RPVQSQNINS SLNTLGNIPP  360
SMFPANQSSG LLQGIPTSIE LNQSKQSNCA TGISPLNQVD SSGFTVASSF PDSRATVNGS  420
NNSLPCVSNN RIMLQGNPQQ THSPGAFKNQ PSVRAASLSA EPFDMGVCGS SNLLDYNRCN  480
ENWQSAAHLS KFPANSLPLC DAFGNDQLPP TSINVSNSTT HIGNSSADFS SRMTIPVSLD  540
DARNELRCQE GLIGNIVQPS SYASQQRWEE RLDYNQSMNR PFNPGNSHAS SSGVTNIRLK  600
SNEAYILEQM KSQDGFMQNT FSTLDDLMGA MVKRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-25207270164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_22328
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0942040.0BT094204.1 Soybean clone JCVI-FLGm-18G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020222711.10.0two-component response regulator ORR24 isoform X1
SwissprotQ6K8X61e-144ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A151T0L10.0A0A151T0L1_CAJCA; Two-component response regulator
STRINGGLYMA15G24770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-128response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]