PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_21187
Common NameKK1_021816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family WOX
Protein Properties Length: 244aa    MW: 27537.9 Da    PI: 5.9414
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_21187genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.8e-212383257
                   T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   ++R+++tkeq+  Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  C.cajan_21187 23 SSRWNPTKEQISMLENLYKQgIKTPSAEEIQQITARLrvygHIEGKNVFYWFQNHKARQRQ 83
                   58*****************99**************************************97 PP

2Wus_type_Homeobox114.84.1e-372285265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
      C.cajan_21187 22 PSSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRVYGHIEGKNVFYWFQNHKARQRQKQ 85
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1751984IPR001356Homeobox domain
SMARTSM003895.1E-82188IPR001356Homeobox domain
CDDcd000862.35E-82285No hitNo description
SuperFamilySSF466895.99E-132390IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-92483IPR009057Homeodomain-like
PfamPF000465.1E-192483IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MESKNNDEVE VVEMGGSNGV PPSSRWNPTK EQISMLENLY KQGIKTPSAE EIQQITARLR  60
VYGHIEGKNV FYWFQNHKAR QRQKQKQETI AYFNRFLHTP QPFFSPPICP NAMCAPYFIP  120
QAQSEIGFYP PHSKVLVPVG FRRSTCEKVV PTGMSNMFNG PVVYEERISD CNLSYSNQET  180
LDLFPLHPTG ILEGKTTDQV YSLAAVSADT STDTPFASPD INQDHASQLN QPFFDFFTSS  240
GQPS
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_21187
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352951e-121AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020215346.10.0WUSCHEL-related homeobox 2
TrEMBLA0A151TMG60.0A0A151TMG6_CAJCA; WUSCHEL-related homeobox 2
STRINGGLYMA11G14940.21e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-58WUSCHEL related homeobox 2