PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20790
Common NameKK1_021411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 290aa    MW: 32312.6 Da    PI: 9.4274
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20790genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-131761147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    C.cajan_20790 17 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 61
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171167IPR009057Homeodomain-like
PROSITE profilePS5129415.4081266IPR017930Myb domain
TIGRFAMsTIGR015571.2E-181564IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.3E-71567IPR009057Homeodomain-like
SMARTSM007175.3E-111664IPR001005SANT/Myb domain
PfamPF002492.3E-111761IPR001005SANT/Myb domain
CDDcd001671.51E-81962No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
ECPNKKLRKP YTITKSRESW TEQEHDKFLE ALQLFDRDWK KIEAFVGSKT VIQIRSHAQK  60
YFLKVQKNGT SEHVPPPRPK RKAAHPYPQK APKIAATASQ LTGSLQSPSA FVEPTYIYSS  120
DSSSVLGNPV TSMPLSSWNY NATPPPVNVP QPQVIRDGMG LTGAGQAVPH NCCYSSSNES  180
TPPTWPSSKT INQGDQGKPF KVMPDFAQVY SFLGSVFDPN STNHLHKLRQ MDPINVETVL  240
LLMRNLSINL MSPEFEDHKK LLSSYDTDSE KSKFVNICST NKSESAVLSA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_20790
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020215427.10.0protein REVEILLE 5 isoform X1
RefseqXP_029127919.10.0protein REVEILLE 5 isoform X2
SwissprotC0SVG51e-102RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A151UCW20.0A0A151UCW2_CAJCA; Myb-like protein G (Fragment)
STRINGGLYMA16G03640.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-88MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]