PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20664
Common NameKK1_021281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 687aa    MW: 75750.1 Da    PI: 6.7516
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20664genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.7e-214398156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  C.cajan_20664 43 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 98
                   688999***********************************************999 PP

2START209.11.7e-652044281206
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+Wv+ +    e++n +e++++f++  +     + +ea r+ g+v+ ++  lve+l+d++ +W e+++    + +t+e
  C.cajan_20664 204 ELALAAMDELVKMAQTGEPLWVRNVeggrEILNHEEYVRSFTPCIGlrpngFVSEATRENGMVIINSLALVETLMDSN-RWAEMFPciiaRTSTTE 298
                    5899**************************************9999****9***************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +  + +v +++lpSg+++++++ng+skvtwveh+++
  C.cajan_20664 299 VISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRESSGAPTFVNCRRLPSGCVVQDMPNGYSKVTWVEHAEY 394
                    ***********************************************************999********************************** PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++++h+l+r+l++sg+ +g ++wvatlqrqce+
  C.cajan_20664 395 DESQVHQLYRPLLSSGMGFGSQRWVATLQRQCEC 428
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-2126100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-2230100IPR009057Homeodomain-like
PROSITE profilePS5007117.21640100IPR001356Homeobox domain
SMARTSM003899.9E-1841104IPR001356Homeobox domain
CDDcd000861.89E-1842100No hitNo description
PfamPF000461.1E-184398IPR001356Homeobox domain
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PROSITE profilePS5084844.574195431IPR002913START domain
SuperFamilySSF559614.4E-33198428No hitNo description
CDDcd088757.14E-127199427No hitNo description
SMARTSM002344.1E-49204428IPR002913START domain
PfamPF018524.4E-57204428IPR002913START domain
SuperFamilySSF559611.1E-24449673No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MDNFEPNGLR RSREEEHESR SGSDNMDGAS GDEHDAADNP PRKKRYHRHT PQQIQELEAL  60
FKECPHPDEK QRLELSKRLC LETRQVKFWF QNRRTQMKTQ LERHENTLLR QENDKLRAEN  120
MSIRDAMRNP MCSNCGGPAI IGEISLEEQH LRIENARLKD ELDRVCALAG KFLGRPVSSL  180
PNSSLELGVG GNNNGSVERS MFLELALAAM DELVKMAQTG EPLWVRNVEG GREILNHEEY  240
VRSFTPCIGL RPNGFVSEAT RENGMVIINS LALVETLMDS NRWAEMFPCI IARTSTTEVI  300
SNGINGTRNG ALQLMHAELQ VLSPLVPVRE VNFLRFCKQH AEGVWAVVDV SIDSIRESSG  360
APTFVNCRRL PSGCVVQDMP NGYSKVTWVE HAEYDESQVH QLYRPLLSSG MGFGSQRWVA  420
TLQRQCECLA ILMSSAAPSR DHSAITAGGR RSMLKLAQRM TNNFCAGVCA STVHKWNKLS  480
PGNVDEDVRV MTRKSPPGVV LSAATSVWLP VSPHRLFHFL RDERLRSEWD ILSNGGPMQE  540
MAHIAKGQDH GNCVSLLRAS AINSNQSSML ILQETCIDAA GSLVVYAPVD IPAMHVVMNG  600
GDSAYVALLP SGFAIVPDGP GSRGPTATTN GADNGGARVS GSLLTVAFQI LVNSLPTAKL  660
TVESVETVNN LISCTVQKIK AALHCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_20664
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237185.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_020237261.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A151UCG50.0A0A151UCG5_CAJCA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]