PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20216
Common NameKK1_020817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 272aa    MW: 31111.9 Da    PI: 6.5109
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20216genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.3e-1880133356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    k+++++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  C.cajan_20216  80 KKRRLNLEQVKALEKSFELGNKLEPERKVQLAKTLGLQPRQIAIWFQNRRARWK 133
                    4557899**********************************************9 PP

2HD-ZIP_I/II126.11.5e-4079171193
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    ekkrrl+ eqvk+LE+sFe  +kLeperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n+ L+ ++++L++el++
  C.cajan_20216  79 EKKRRLNLEQVKALEKSFELGNKLEPERKVQLAKTLGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKAHNDVLKVQNQKLHAELQA 171
                    69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.60175135IPR001356Homeobox domain
SuperFamilySSF466894.6E-1976137IPR009057Homeodomain-like
SMARTSM003892.1E-1878139IPR001356Homeobox domain
CDDcd000862.07E-1680136No hitNo description
PfamPF000463.4E-1580133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1887134IPR009057Homeodomain-like
PRINTSPR000319.3E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000319.3E-6115131IPR000047Helix-turn-helix motif
PfamPF021834.2E-12135174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAFPPSHSFM FNTHEEEHHE HLPSTSLNDF PSLPPQLFQV GAPFMLKQSM SFSGIDNKCD  60
ALVDGDDELS DDGIFQCGEK KRRLNLEQVK ALEKSFELGN KLEPERKVQL AKTLGLQPRQ  120
IAIWFQNRRA RWKTKQLEKE YEVLKKQFEA VKAHNDVLKV QNQKLHAELQ AVKSRDWPEA  180
GTISLNKETE GSWANGSGNS LDINLDLSST PVLNSSVSSQ IPTLKSTSIN QILQSSSRPD  240
LQDEAFCNML HNIDAQQNFW PWPNQHHHQY FH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_20216
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351191e-129AC235119.1 Glycine max strain Williams 82 clone GM_WBa0029B22, complete sequence.
GenBankAC2352401e-129AC235240.1 Glycine max strain Williams 82 clone GM_WBb0029M05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020215567.10.0homeobox-leucine zipper protein HAT7 isoform X1
SwissprotQ004662e-71HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A151UB710.0A0A151UB71_CAJCA; Homeobox-leucine zipper protein HAT7
STRINGXP_007139587.11e-150(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-71homeobox 3