PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20131
Common NameKK1_020730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 365aa    MW: 39953.1 Da    PI: 5.8687
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20131genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21e-051353340
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg...Htvv 40
                   +r+C+++     + fC+  + +lC+ C    H +   H++v
  C.cajan_20131 13 PRTCDTCRAAASTVFCRAHSFFLCAACDARLHASpswHERV 53
                   589******99*********************878888865 PP

2zf-B_box28.62.9e-095398342
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                    ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  C.cajan_20131 53 VWVCEACERAPAAFLCKADAASLCSSCDADIHSAnplagrHHRVPI 98
                   689*****************************66899999877775 PP

3CCT70.44.4e-24296339144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  C.cajan_20131 296 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 339
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.91148IPR000315B-box-type zinc finger
CDDcd000212.27E-41455No hitNo description
PROSITE profilePS501199.3431655IPR000315B-box-type zinc finger
SMARTSM003362.7E-135198IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8085198IPR000315B-box-type zinc finger
PfamPF006431.8E-75298IPR000315B-box-type zinc finger
CDDcd000218.27E-85498No hitNo description
PfamPF062037.0E-18296338IPR010402CCT domain
PROSITE profilePS5101716.648296338IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MLEGGEPAAT WAPRTCDTCR AAASTVFCRA HSFFLCAACD ARLHASPSWH ERVWVCEACE  60
RAPAAFLCKA DAASLCSSCD ADIHSANPLA GRHHRVPILP ISSSSSAAAA PHHHDDDDDA  120
DADADDDDET ASWLLLNPLK SATVPNNNDS NNNNGFLYGG EVDEYLDLVD NCNSCGDNSN  180
HFTAATTTTD DYAQHQHFDG VSHHKSYAGD SVVPVQQHHH FQLSLEFDNN NNNKASFGFN  240
ASVSQSVSVS SMDVGVVPES TMMDVSIGHS RPPKGTIDLF SGPSIQMPSH LTPMDREARV  300
LRYREKKKTR KFEKTIRYAS RKAYAETRPR IKGRFAKRTD VEAEVDQMFS TTLITEVGYG  360
IVPSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_20131
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020210873.10.0zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-122COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A151UAZ10.0A0A151UAZ1_CAJCA; Zinc finger protein CONSTANS-LIKE 2
STRINGXP_007139358.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-78CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]