PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18986
Common NameKK1_019538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GATA
Protein Properties Length: 297aa    MW: 32731.6 Da    PI: 6.5093
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18986genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.8e-19212245134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  C.cajan_18986 212 CSHCQVQKTPQWRTGPLGPKTLCNACGVRYKSGR 245
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.1E-7927296IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.372206242IPR000679Zinc finger, GATA-type
SMARTSM004017.8E-15206260IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.42E-14208269No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14210243IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.73E-14211268No hitNo description
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
PfamPF003201.4E-16212245IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEVAVDKALK PSLRREFIVQ QTLCEEIFCL NANAGGAGAG EDFSVDDLLD FSNGEEYNEE  60
TESVSVSSQS QDRGEDDSNS NSTGVSCDSF FSTELAVPAG DLEDLEWVSH FVDDSLPELS  120
LLYPVRSEEA NRWVEPEASA KKTPRFPWEM KVRTKARTVR SRNPSAWPTL GPLLSLPSSP  180
SSCSSSVTEP PAKKQKKRAE AQPVGAQIQR RCSHCQVQKT PQWRTGPLGP KTLCNACGVR  240
YKSGRLFSEY RPACSPTFRS DIHSNSHRKV LEMRKRKGEA GPAATLAQAQ TQMVLTC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527135.11e-152PREDICTED: GATA transcription factor 7-like
TrEMBLA0A151TD120.0A0A151TD12_CAJCA; GATA transcription factor 12
STRINGGLYMA06G01110.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.17e-47GATA transcription factor 7