PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18982
Common NameKK1_019534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family DBB
Protein Properties Length: 198aa    MW: 21940.6 Da    PI: 6.4862
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18982genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.93.6e-07435536
       zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg 36
                    C+ +++ e+  fC  ++  lC++C  ++H+ 
  C.cajan_18982  4 QCDVCDKVEALVFCPADEAALCHTCDRTIHHA 35
                   7******99********************744 PP

2zf-B_box29.71.3e-095692438
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Ht 38
                   + C+ ++ek++  fC++++  lC++C l +H+   Ht
  C.cajan_18982 56 PLCDICQEKRAYVFCQEDRAILCRECDLPIHRAneHT 92
                   68*****************************767865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.352147IPR000315B-box-type zinc finger
CDDcd000217.59E-5333No hitNo description
SMARTSM003362.0E-6447IPR000315B-box-type zinc finger
SMARTSM003366.1E-1553100IPR000315B-box-type zinc finger
PROSITE profilePS5011910.23953100IPR000315B-box-type zinc finger
CDDcd000218.82E-956100No hitNo description
PfamPF006433.7E-85692IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0080167Biological Processresponse to karrikin
GO:1900458Biological Processnegative regulation of brassinosteroid mediated signaling pathway
GO:2000306Biological Processpositive regulation of photomorphogenesis
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MKIQCDVCDK VEALVFCPAD EAALCHTCDR TIHHANKLAT KHARFSLHYP TSQDFPLCDI  60
CQEKRAYVFC QEDRAILCRE CDLPIHRANE HTQNHNRFLL TGVKLSGTSL DPISSSSTNC  120
TTGSQARSKM NRPRSVSNEN ASSSFKVEDN VASDTGSVST TTSSISEYLI ETIPGYCFED  180
LLDASFAPNG FCKVCYKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150358e-52AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629884.11e-115PREDICTED: B-box zinc finger protein 20-like isoform X2
RefseqXP_014629883.11e-115PREDICTED: B-box zinc finger protein 20-like isoform X1
SwissprotQ0IGM72e-62BBX20_ARATH; B-box zinc finger protein 20
TrEMBLA0A151TCY91e-147A0A151TCY9_CAJCA; Putative salt tolerance-like protein At1g75540 family
STRINGGLYMA04G01120.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14483494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39070.13e-62DBB family protein