PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18433
Common NameKK1_018972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 757aa    MW: 83006.9 Da    PI: 6.509
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18433genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.1e-21121176156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  C.cajan_18433 121 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLSLETRQVKFWFQNRRTQMK 176
                    688999***********************************************999 PP

2START2053.1e-642895131206
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+W +s     e++n +e+++++++  +     + +ea+r +g+v+ ++  lve+l+d++ +W+e+++    + +t e
  C.cajan_18433 289 ELALSAMDELVKMAQTGEPLWIRSLeggrEILNHEEYTRTITPCIGlrpngFVTEASRQTGMVIINSLALVETLMDSN-RWSEMFPcmiaRTSTAE 383
                    57899************************************999989***9***************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng+skvtwveh+++
  C.cajan_18433 384 VISSGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGLWAVVDVSIDTIRETSGAPTFVNCRRLPSGCVVQDMPNGYSKVTWVEHAEY 479
                    ***********************************************************999********************************** PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++++h+l+r+l++sg+ +ga++wvatlqrqce+
  C.cajan_18433 480 DESQVHQLYRPLLSSGTGFGAQRWVATLQRQCEC 513
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-21104178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-21108172IPR009057Homeodomain-like
PROSITE profilePS5007117.605118178IPR001356Homeobox domain
SMARTSM003894.1E-19119182IPR001356Homeobox domain
CDDcd000861.20E-18120178No hitNo description
PfamPF000461.7E-18121176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PROSITE profilePS5084844.672280516IPR002913START domain
SuperFamilySSF559611.32E-34283513No hitNo description
CDDcd088752.05E-126284512No hitNo description
SMARTSM002347.9E-47289513IPR002913START domain
PfamPF018529.6E-56289513IPR002913START domain
SuperFamilySSF559613.52E-20535744No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MSFGGFLENK QSGGGGRIVA DIPYSNGSNH SNDIMPSGAI SQPRLATPTL AKSMFNSPGL  60
SLALQSDIDG QGDVNRLMPE SFEQNGLRRN REEEHESRSG SDNMDGASGD DFDAADNPPR  120
KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSRRLSLE TRQVKFWFQN RRTQMKTQLE  180
RHENSLLRQE NDKLRAENMS MREAMRNPIC SNCGGPAMIG EISLEEQHLR IENARLKDEL  240
DRVCALAGKF LGRPISSLTS SIGPPMPNSS LELGVGSNGF GVERSIVLEL ALSAMDELVK  300
MAQTGEPLWI RSLEGGREIL NHEEYTRTIT PCIGLRPNGF VTEASRQTGM VIINSLALVE  360
TLMDSNRWSE MFPCMIARTS TAEVISSGIN GTRNGALQLM HAELQVLSPL VPVREVNFLR  420
FCKQHAEGLW AVVDVSIDTI RETSGAPTFV NCRRLPSGCV VQDMPNGYSK VTWVEHAEYD  480
ESQVHQLYRP LLSSGTGFGA QRWVATLQRQ CECLAILMSS AAPSREHSAI SAGGRRSMLK  540
LAQRMTNNFC AGVCASTVHK WNKLNAGNVG EDVRVMTRKS XWLPVSPQRL FDFLRDERLR  600
SEWDILSNGG PMQEMAHIAK GQDHANCVSL LRASAINANQ SSMLILQETC TDASGSLVVY  660
APVDIPAMHV VMNGGDSAYV ALLPSGFSIV PDGSGGGEDQ GGVASQARAG GCLLTVAFQI  720
LVNSLPTAKL TVESVETVNN LISCTVQKIK AALHCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_18433
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020219711.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A151TBG80.0A0A151TBG8_CAJCA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]