PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18311
Common NameKK1_018846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 308aa    MW: 34993.7 Da    PI: 10.3259
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18311genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-133781147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    C.cajan_18311 37 RENWTDQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 81
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-163187IPR009057Homeodomain-like
PROSITE profilePS5129414.7973286IPR017930Myb domain
TIGRFAMsTIGR015573.4E-173584IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-63587IPR009057Homeodomain-like
SMARTSM007175.6E-113684IPR001005SANT/Myb domain
PfamPF002493.4E-113781IPR001005SANT/Myb domain
CDDcd001672.12E-83982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVSLNPNPPQ TFHFFDTFNM EVPNKKIRKP YTITKSRENW TDQEHDKFLE ALHLFDRDWK  60
KIEAFVGSKT VIQIRSHAQK YFMKVQKNGT SEHVPPPRPK RKAAHPYPQK ASKNALTIPQ  120
VKRPLQSSSS LSESSYIYRP DSSSVLRTPV SSVPLPSWNY NVTPPVSLPQ VTKDDRMLSQ  180
QAIPFNHCYS SSNESTPRGW PSSKHTDQAD QGKPIKVMPD FAQVYSFIGS VFDPKATNHL  240
QTLKQMDPIN VETVLLLMRN LSTNLRSPEF ENDKRLLSSY NANLEKGKSG SHLRNSLTGR  300
SESAVLTA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_18311
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020219104.10.0protein REVEILLE 6
SwissprotC0SVG54e-99RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A151TB740.0A0A151TB74_CAJCA; Myb-like protein G
STRINGGLYMA18G47230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.12e-85MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]