PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15977
Common NameKK1_016444
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 291aa    MW: 32228.8 Da    PI: 9.7826
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15977genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-125498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    C.cajan_15977 54 RENWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 98
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-1648104IPR009057Homeodomain-like
PROSITE profilePS5129414.14349103IPR017930Myb domain
TIGRFAMsTIGR015571.7E-1852101IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.4E-652104IPR009057Homeodomain-like
SMARTSM007174.8E-1053101IPR001005SANT/Myb domain
PfamPF002493.6E-105498IPR001005SANT/Myb domain
CDDcd001677.70E-85699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVSKNPNPPE GFYLDPTGMA LSGMPPFASV SAAANSPEDA AKKIRKPYTI TKSRENWTEP  60
EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KVQKSGTSEH LPPPRPKRKA  120
AHPYPQKASK NAPVLSQVSG SLQSSPALLE PGCILKNDSS PMLKSPIMNT VVSSWSNNTL  180
QAINLSPVAK VNICSSGEST PKVRPVGESN GQGNKIHPLR VLPDFTQVYG FIGSVFDPNA  240
TEHLQKLKEM DRIDVETVLL LMRNLSINLT SPDFEDHRKV LSSYEVEARE K
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_15977
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0932340.0BT093234.1 Soybean clone JCVI-FLGm-17C23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020221987.10.0protein REVEILLE 6
SwissprotQ8H0W31e-120RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A151T4G00.0A0A151T4G0_CAJCA; Myb-like protein G
STRINGGLYMA16G29740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-103MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]