PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15709
Common NameKK1_016171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 177aa    MW: 19975 Da    PI: 10.3681
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15709genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.37.1e-221257449
                   -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   ++   +qvtfskRr+g++KKA+ELS+LC++eva+++fs+ +k y +
  C.cajan_15709 12 KDPNTKQVTFSKRRKGLFKKANELSILCGVEVAIVVFSPGNKPYSF 57
                   566779*********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.01E-27173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.623161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-32160IPR002100Transcription factor, MADS-box
CDDcd002651.65E-31276No hitNo description
PRINTSPR004043.8E-19323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-251257IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRRKIEIAE VKDPNTKQVT FSKRRKGLFK KANELSILCG VEVAIVVFSP GNKPYSFGHP  60
SVDAVAAKFL EPNDVQGNGS PNINEVGDME MLNQQLSNVE AQILEQQKKA TKLGERLRKH  120
EVKQLSKPRE SQDSFSQLQH NTKDYFDAIE VSECLMLLAQ QPVVGIKKRV SKKRRKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-19174174MEF2C
5f28_B8e-19174174MEF2C
5f28_C8e-19174174MEF2C
5f28_D8e-19174174MEF2C
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171175KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_15709
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020222045.11e-128agamous-like MADS-box protein AGL29
TrEMBLA0A151T3P31e-126A0A151T3P3_CAJCA; Agamous-like MADS-box protein AGL61
STRINGGLYMA05G35820.11e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.18e-36AGAMOUS-like 29