PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15708
Common NameKK1_016170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 170aa    MW: 19429.6 Da    PI: 10.2486
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15708genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.17.5e-211157349
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +++   +qvtfskRr+g++ KA+ELS+LC++e+a+i+fs+ +k y +
  C.cajan_15708 11 VKDPNTKQVTFSKRRTGLFRKANELSILCGIEIAIIVFSPGNKPYSF 57
                   5677789*********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.06E-27174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.016161IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-32160IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-19323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGRRKIEIKE VKDPNTKQVT FSKRRTGLFR KANELSILCG IEIAIIVFSP GNKPYSFGHP  60
SVDAVTAKFL QQEPKSNNEV GHDIDMETLN KQLFDVQAQI RKEQKKAAKL DARMKQHKVT  120
QLSHQQLKDS FSELQYNVKD YIDAIEVSEC MMLLAKEPVV GIKKQVSKKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-18192191MEF2C
5f28_B1e-18192191MEF2C
5f28_C1e-18192191MEF2C
5f28_D1e-18192191MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_15708
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150344e-56AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020220161.11e-123agamous-like MADS-box protein AGL29
TrEMBLA0A151T3N91e-122A0A151T3N9_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA05G35820.17e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-34AGAMOUS-like 29