PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15626
Common NameKK1_016075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 368aa    MW: 41626.6 Da    PI: 5.3792
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15626genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box247.8e-081558340
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                   +r C+ + + ++++fC  ++ +lC+ C +  H+       H++v
  C.cajan_15626 15 ARACDSCIRRRARWFCAADDAFLCHGCDTLVHSAnqlasrHERV 58
                   578*****************************667888888876 PP

2CCT66.95.8e-23313355143
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                    Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+
  C.cajan_15626 313 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR 355
                    9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.3381360IPR000315B-box-type zinc finger
SMARTSM003366.2E-91360IPR000315B-box-type zinc finger
PfamPF006432.0E-61559IPR000315B-box-type zinc finger
CDDcd000212.48E-81660No hitNo description
PfamPF062038.0E-18313355IPR010402CCT domain
PROSITE profilePS5101715.993313355IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MRDMKDTGAL GGKTARACDS CIRRRARWFC AADDAFLCHG CDTLVHSANQ LASRHERVRI  60
QTASSKVTTT THAWHSGFTR KARTPRHNNN KHFALQQRLK DEVLFNNNSV LPLVPELGGE  120
EPVVVDNDET EEQMLCRVPV LEFDPFEMRT DDLDSFSDMD FAEFAADVES LLDKEDDEIS  180
ASVGVEGAMV KVKDEEEVDG DVACYLESVF DMTNDDAFRW NNIESVLSAA REEKEEGVVA  240
CDGGVINEEG GTKRDIFLRL NYDEVITAWS SQGSSPWTTP NPPKFNSDYD FCLGLSGVDG  300
EMRSLRGHLD GGREARVSRY REKRRTRLFA KKIRYEVRKL NAEKRPRMKG RFVKRTCFVG  360
ATAFPAYH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1323339RRTRLFAKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_15626
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0689000.0HM068900.1 Glycine max CONSTANS-like zinc finger protein (COL19) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029128141.10.0zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A151T3K40.0A0A151T3K4_CAJCA; Zinc finger protein CONSTANS-LIKE 6
STRINGGLYMA05G35151.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.15e-81B-box type zinc finger protein with CCT domain