PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_14729
Common NameKK1_015163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LFY
Protein Properties Length: 365aa    MW: 41284.3 Da    PI: 6.7389
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_14729genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY619.36.9e-1891135142386
        FLO_LFY  42 aaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsede 137
                    aaa r+l +leelf+ayG+ry+t+akiaelGftvstLvdmkdeeldd+m+sls+ifr+dllvGeryGikaavraerrr+++++ +++ ++lls+d+
  C.cajan_14729  11 AAAPRELGGLEELFQAYGIRYFTAAKIAELGFTVSTLVDMKDEELDDMMNSLSQIFRWDLLVGERYGIKAAVRAERRRVDDDDLKRRSNNLLSADT 106
                    455566889**************************************************************************9999999999998 PP

        FLO_LFY 138 et.aldalsqeglseepvqe.ekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqreh 231
                    +t aldalsqeglseepv + ekea+gsgg++  ++e++aaee++++++++++   + k + +++++++  e+ee ee++++++++ +g erqreh
  C.cajan_14729 107 TTnALDALSQEGLSEEPVVQrEKEAVGSGGGS--TWEVAAAEERRKQQRRRRT---RMKVNIHHDENEDL-EEEEGEENDEGNNNSGGGCERQREH 196
                    777**************999677788888877..9999999854443333333...22333222222222.2333344444455566688****** PP

        FLO_LFY 232 PfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafk 327
                    PfivtepgevargkknGLDYLf+LyeqCrefL+qvq+iak+rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdee sn+lrrafk
  C.cajan_14729 197 PFIVTEPGEVARGKKNGLDYLFHLYEQCREFLMQVQAIAKDRGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEVSNELRRAFK 292
                    ************************************************************************************************ PP

        FLO_LFY 328 ergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                    ergenvGawrqacykplvaiaarqgwdida+fnahprLsiWYvPtkLrqLCh+er++a+
  C.cajan_14729 293 ERGENVGAWRQACYKPLVAIAARQGWDIDAIFNAHPRLSIWYVPTKLRQLCHAERNSAA 351
                    *******************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.9E-1993351IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAPAAFHPAR AAAPRELGGL EELFQAYGIR YFTAAKIAEL GFTVSTLVDM KDEELDDMMN  60
SLSQIFRWDL LVGERYGIKA AVRAERRRVD DDDLKRRSNN LLSADTTTNA LDALSQEGLS  120
EEPVVQREKE AVGSGGGSTW EVAAAEERRK QQRRRRTRMK VNIHHDENED LEEEEGEEND  180
EGNNNSGGGC ERQREHPFIV TEPGEVARGK KNGLDYLFHL YEQCREFLMQ VQAIAKDRGE  240
KCPTKVTNQV FRYAKKAGAS YINKPKMRHY VHCYALHCLD EEVSNELRRA FKERGENVGA  300
WRQACYKPLV AIAARQGWDI DAIFNAHPRL SIWYVPTKLR QLCHAERNSA AASSSVSAGS  360
AHLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1111893592172PROTEIN LEAFY
2vy2_A1e-1111893592172PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_14729
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4488100.0DQ448810.1 Glycine max LEAFY-like protein (LFY) mRNA, LFY-1 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020224595.10.0protein UNIFOLIATA, partial
SwissprotO485590.0UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A151SY570.0A0A151SY57_CAJCA; Protein UNIFOLIATA
STRINGGLYMA06G17170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-149floral meristem identity control protein LEAFY (LFY)