PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_14273
Common NameKK1_014701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 388aa    MW: 42981.3 Da    PI: 6.1973
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_14273genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-17201255256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  C.cajan_14273 201 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 255
                    778899***********************************************98 PP

2HD-ZIP_I/II127.94.2e-41201291192
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                    +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  C.cajan_14273 201 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 291
                    69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.4E-4108155IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.9E-18181258IPR009057Homeodomain-like
SuperFamilySSF466891.2E-18188258IPR009057Homeodomain-like
PROSITE profilePS5007117.184197257IPR001356Homeobox domain
SMARTSM003891.3E-15199261IPR001356Homeobox domain
CDDcd000865.17E-15201258No hitNo description
PfamPF000465.3E-15201255IPR001356Homeobox domain
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
SMARTSM003409.1E-26257300IPR003106Leucine zipper, homeobox-associated
PfamPF021836.1E-11257291IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLGFMEK PREASNQLGL GFNTTLSIGP IITRQKDHED QELEEEEEEE  60
TKPKKHKNNI NNLTTEDPND LSSKPNNNNP VLHQLDLLPQ LSFPWHPPSE NGSLSSDLGG  120
SSRGLDVNAQ PAAAEEEAEE AAALSSSPNS AASSFQMDLC IYSNRGGSFY KRDSEGEAYD  180
QRASSRASDE DDTNGGPANT RKKLRLSKEQ SAFLEESFKE HNTLNPKQKL ALAKQLNLRP  240
RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ETLTEENRRL HKELQELRAL KTSNPFYMQL  300
PATTLTMCPS CERVATNSTT TSSSLGATIN ANSGTMASVK TSNNNNTITN DSNSNSNSKA  360
IGFPFGKPRF HPFVHASQQS HQHQSPAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199205TRKKLRL
2249257RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_14273
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020223883.10.0homeobox-leucine zipper protein HOX11
SwissprotA2YW032e-88HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLA0A151SWW60.0A0A151SWW6_CAJCA; Homeobox-leucine zipper protein HOX27
STRINGXP_007149086.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-68homeobox from Arabidopsis thaliana