PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13551
Common NameKK1_013967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family WOX
Protein Properties Length: 225aa    MW: 25266.2 Da    PI: 8.2428
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13551genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.5e-191877357
                   --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   +R+++tkeq+ +Le+l+++  r+p+a++++++ ++l    +++ ++V++WFqN++a++++
  C.cajan_13551 18 SRWSPTKEQISTLENLYKQgIRTPNASQIQHIVTRLsaygHIEGKNVFYWFQNHKARQRQ 77
                   6*****************99**************************************97 PP

2Wus_type_Homeobox110.59.3e-361778364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +RW+Pt+eQi  Le+lyk+G+rtPn+++iq+i ++L++yG+ie+kNVfyWFQN+kaR+rqk
      C.cajan_13551 17 VSRWSPTKEQISTLENLYKQGIRTPNASQIQHIVTRLSAYGHIEGKNVFYWFQNHKARQRQK 78
                       68***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.4951378IPR001356Homeobox domain
SuperFamilySSF466896.84E-121483IPR009057Homeodomain-like
SMARTSM003891.5E-41582IPR001356Homeobox domain
PfamPF000465.6E-171877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.1E-81877IPR009057Homeodomain-like
CDDcd000861.71E-51978No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MESEAAEVEM RRRGHSVSRW SPTKEQISTL ENLYKQGIRT PNASQIQHIV TRLSAYGHIE  60
GKNVFYWFQN HKARQRQKLK LKQQNVGSSN HFLHASQPIC QNVVCGPYCL QQSGTGFYSQ  120
QPPKVLASGV SSSIVTFGLQ RMCDGSQRNE LLQQDYNSRT SNHKALTLFP LHPTSILEEK  180
SSQVPSLASF CEGAIDTSSA AHINEDAHPE NLPFFDFFTS SHVSD
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_13551
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020223431.11e-141WUSCHEL-related homeobox 1
TrEMBLA0A151SUS21e-168A0A151SUS2_CAJCA; WUSCHEL-related homeobox 2
STRINGGLYMA13G41000.18e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.19e-34WUSCHEL related homeobox 2