PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13317
Common NameKK1_013725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 223aa    MW: 25132.9 Da    PI: 9.6572
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13317genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.33.1e-211764249
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +i  ks  qvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k + +
  C.cajan_13317 17 KIPKKSHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPADKAFSF 64
                   57789999*********************************9987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.932868IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-29867IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-25980IPR002100Transcription factor, MADS-box
CDDcd002651.93E-33985No hitNo description
PRINTSPR004045.1E-171030IPR002100Transcription factor, MADS-box
PfamPF003192.3E-231764IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-173045IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-174566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MIKRKCSSGR QKIPIEKIPK KSHLQVTFSK RRSGLFKKAS ELCTLCGVEI AIIVFSPADK  60
AFSFGHPEVE SIIDSYLTPN SSLESSSGHQ LVEVHRNANI GNLNMQLTQI LNQLEIEKKQ  120
GEELDRVWKT RQSKFWWEIP VPQLGLHELQ HLMFSMEELK KNVAKYATQM LMDQNNVPAP  180
VNGPGPAPNG FGPFDAFGHK PPQIYANVNS STLINPSAFN FRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-16993185Myocyte-specific enhancer factor 2A
3kov_B7e-16993185Myocyte-specific enhancer factor 2A
3kov_I7e-16993185Myocyte-specific enhancer factor 2A
3kov_J7e-16993185Myocyte-specific enhancer factor 2A
3p57_A7e-16993185Myocyte-specific enhancer factor 2A
3p57_B7e-16993185Myocyte-specific enhancer factor 2A
3p57_C7e-16993185Myocyte-specific enhancer factor 2A
3p57_D7e-16993185Myocyte-specific enhancer factor 2A
3p57_I7e-16993185Myocyte-specific enhancer factor 2A
3p57_J7e-16993185Myocyte-specific enhancer factor 2A
5f28_A7e-16993286MEF2C
5f28_B7e-16993286MEF2C
5f28_C7e-16993286MEF2C
5f28_D7e-16993286MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_13317
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020216947.21e-167agamous-like MADS-box protein AGL61
TrEMBLA0A151TK321e-165A0A151TK32_CAJCA; Agamous-like MADS-box protein AGL62
STRINGXP_007157187.11e-110(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-51AGAMOUS-like 61