PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13158
Common NameKK1_013563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TALE
Protein Properties Length: 270aa    MW: 31006.1 Da    PI: 7.2649
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13158genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.8e-072192522154
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    k +yp+++++++L +++gL+ +q+ +WF N+R +
  C.cajan_13158 219 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 252
                    469*****************************87 PP

2ELK25.62.7e-09173194122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK +L++++++++ ++++E++
  C.cajan_13158 173 ELKIELKQGFKSRIEDVREEIL 194
                    9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-18751IPR005540KNOX1
PfamPF037907.0E-17950IPR005540KNOX1
SMARTSM012563.4E-2262117IPR005541KNOX2
PfamPF037912.3E-1666116IPR005541KNOX2
PROSITE profilePS512139.132173193IPR005539ELK domain
PROSITE profilePS5007111.71193256IPR001356Homeobox domain
SMARTSM003895.3E-11195260IPR001356Homeobox domain
SuperFamilySSF466892.69E-16195260IPR009057Homeodomain-like
CDDcd000861.01E-11196257No hitNo description
Gene3DG3DSA:1.10.10.603.5E-25200258IPR009057Homeodomain-like
PfamPF059209.3E-18213252IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAADHHRQLK AEIATHPLYD QLLAAHVACL RVATPIDQLP LIDAQLSHSH HLLRSYVSQH  60
THALSPNHRQ ELDNFLAQYL IVLCTFKEQL QQHVRVHAVE AVMACRDIEN TLQALTGVSL  120
GEGTGATMSD DEDDLQMDFS LDQSSAEGHD MMGFGPLLPT ESERSLMERV RQELKIELKQ  180
GFKSRIEDVR EEILRKRRAG KLPGDTTSVL KNWWQQHAKW PYPTEDDKAK LVEETGLQLK  240
QINNWFINQR KRNWHSNSQS VTSLKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12196252864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249269RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_13158
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0950030.0BT095003.1 Soybean clone JCVI-FLGm-6F23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020217602.10.0homeobox protein HD1
SwissprotP466061e-168HD1_BRANA; Homeobox protein HD1
TrEMBLA0A151TJP40.0A0A151TJP4_CAJCA; Homeobox protein HD1
STRINGXP_007158449.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-168KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]