PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12819
Common NameKK1_013211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GATA
Protein Properties Length: 308aa    MW: 34260.2 Da    PI: 7.263
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12819genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.35e-19223257135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    Cs+Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  C.cajan_12819 223 CSHCGVHKTPQWRTGPLGPKTLCNACGVRFKSGRL 257
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-8211305IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-16217271IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.569217253IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.61E-14219279No hitNo description
Gene3DG3DSA:3.30.50.102.3E-14221255IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.50E-15222270No hitNo description
PROSITE patternPS003440223248IPR000679Zinc finger, GATA-type
PfamPF003208.4E-17223257IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEAALKTNFR KEQTPQNFVE EFSAPNATSS DDFYVDDLLD FSHVQEEPEQ QDPAFLSLQQ  60
QNHARQPSTF EPDYVSVPAT ELSVPADDVA DLEWLSHFVE DSFSEFSAAF PTVTENQMGF  120
KAQEAKPEPE SPHFRFKTPV QTKARSKRSR NGVRVWPLGS PSFTECSSSS TTTSSSSSSS  180
SPSTTTLLIY TNCLQSLDHV CSQPKPKKPK KKTSSDTLAP RRCSHCGVHK TPQWRTGPLG  240
PKTLCNACGV RFKSGRLLPE YRPACSPTFS SELHSNHHRK VLEMRRKKET VAGVESLETI  300
TPASVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242253.11e-137uncharacterized protein LOC100783966
SwissprotQ9FH571e-68GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A151TIM00.0A0A151TIM0_CAJCA; GATA transcription factor 14
STRINGGLYMA01G37450.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.13e-62GATA transcription factor 6