PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10973
Common NameKK1_011297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 766aa    MW: 84241.8 Da    PI: 6.4347
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10973genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
    C.cajan_10973 24 RERWTEDEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-161873IPR009057Homeodomain-like
PROSITE profilePS5129419.151973IPR017930Myb domain
TIGRFAMsTIGR015576.4E-172271IPR006447Myb domain, plants
SMARTSM007172.3E-122371IPR001005SANT/Myb domain
PfamPF002498.4E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-82464IPR009057Homeodomain-like
CDDcd001675.07E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MDAYSSGEEV VIKTRKPYTI TKQRERWTED EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KVNPTDPHIK TMTNTCIFGE PNTKLEKEAF VKGVPIGQAL DIDIPPPRPK  120
RKPNNPYPRK TNVGDPTLHN GVKHGKSLVS IASSHSKQAL DLEKEPLPEK HNKDESCSKV  180
FTIIREAPCS SVSSANKNSL SMSVPLRNSC ALREFIPSIK EIITPDITNE SFITDELENQ  240
KLELDDGKQT QKTNGTCKVS KLENSDASKL IQTAKTEVPN CALTIDGMQS NQNYPRHVPV  300
HVVDGSSTQN PSPDMVFQNS IFQPIGGVNG KPNLVTTSAT SNISESQNNT ARSSIHQSFP  360
LCPLFTQHNQ DDYHSFLHIS STFSSLIVST LLQNPAAHAA ASFAATFWPY ANAETSTDSP  420
VCTPGFPSRQ IGSPPSVTAI AAATVAAATA WWAAHGLLPL CAPPHTAFAC PPASATAVPS  480
MNIGESPQKT EQGEIKPQNP PLQDQIIDPE QSEALQAQHS ASKSPAVSSP ESEESGDANL  540
NTSSKATTNH EMNQTISENP DSNKMKGRKL VDRSSCGSNA TSSSEETELL EKDEKEKEEP  600
KTLEENLLAT ETNNRRSRSI SNLTDSWKEV SEEGRLAFQA LFSREVLPQS FSPPYDLINQ  660
DHQIDRNSFK DNKQNTDYKD EDLESKKCSS NCDGVQKNLP LVKDNSEEEG LLSIGLGQGR  720
LKTRRTGFKP YKRCSVEAKE NMIGTACNQG EEKGPKRIRL NEEAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_10973
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764340.0EU076434.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 2 (LCL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020211113.10.0protein LHY isoform X1
RefseqXP_020211114.10.0protein LHY isoform X1
TrEMBLA0A151TY900.0A0A151TY90_CAJCA; Myb-like protein G
STRINGGLYMA19G45030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-79circadian clock associated 1