PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10816
Common NameKK1_011131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 84aa    MW: 9972.57 Da    PI: 10.158
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10816genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1031e-32959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  C.cajan_10816  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                   79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-32272IPR002100Transcription factor, MADS-box
CDDcd002652.11E-38261No hitNo description
PRINTSPR004041.0E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SRYIYIYIYI NNNILYSWQQ ENGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-20161161MEF2C
5f28_B4e-20161161MEF2C
5f28_C4e-20161161MEF2C
5f28_D4e-20161161MEF2C
6byy_A4e-20161161MEF2 CHIMERA
6byy_B4e-20161161MEF2 CHIMERA
6byy_C4e-20161161MEF2 CHIMERA
6byy_D4e-20161161MEF2 CHIMERA
6bz1_A4e-20161161MEF2 CHIMERA
6bz1_B4e-20161161MEF2 CHIMERA
6bz1_C4e-20161161MEF2 CHIMERA
6bz1_D4e-20161161MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in inflorescence development and floral organogenesis. Functions with SEPALLATA1/AGL2 and SEPALLATA2/AGL4 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Interacts with APETALA1, AGAMOUS or APETALA3/PISTILLATA to form complexes, that could be involved in genes regulation during floral meristem development (PubMed:10821278, PubMed:11206550). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:10821278, ECO:0000269|PubMed:11206550, ECO:0000269|PubMed:16080001}.
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_10816
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0045162e-78AP004516.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT04F23, TM0044b, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546327.12e-39PREDICTED: agamous-like MADS-box protein AGL9 homolog
RefseqXP_022850778.12e-39MADS-box protein EJ2-like
SwissprotO224569e-37SEP3_ARATH; Developmental protein SEPALLATA 3
SwissprotQ8LLR07e-37MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBLA0A151TY114e-53A0A151TY11_CAJCA; Developmental protein SEPALLATA 3
STRINGcassava4.1_030388m1e-37(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.32e-39MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Maejima K, et al.
    Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody.
    Plant J., 2014. 78(4): p. 541-54
    [PMID:24597566]
  4. MacLean AM, et al.
    Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner.
    PLoS Biol., 2014. 12(4): p. e1001835
    [PMID:24714165]
  5. Iglesias FM, et al.
    The arabidopsis DNA polymerase δ has a role in the deposition of transcriptionally active epigenetic marks, development and flowering.
    PLoS Genet., 2015. 11(2): p. e1004975
    [PMID:25693187]
  6. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Arabidopsis thaliana SEPALLATA3 protein prokaryotic expression and purification.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(2): p. 60-3
    [PMID:26025404]
  7. Maejima K, et al.
    Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen.
    Plant Signal Behav, 2015. 10(8): p. e1042635
    [PMID:26179462]
  8. Muiño JM, et al.
    Evolution of DNA-Binding Sites of a Floral Master Regulatory Transcription Factor.
    Mol. Biol. Evol., 2016. 33(1): p. 185-200
    [PMID:26429922]
  9. Shi Q,Zhou J,Wang P,Lin X,Xu Y
    Protein expression and characterization of SEP3 from Arabidopsis thaliana.
    Genet. Mol. Res., 2015. 14(4): p. 12529-36
    [PMID:26505403]
  10. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Cloning, Prokaryotic Expression and Purification of CpfS1 Gene from Arabidopsis Thaliana.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(8): p. 123-7
    [PMID:26718440]
  11. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  12. Soza VL,Snelson CD,Hewett Hazelton KD,Di Stilio VS
    Partial redundancy and functional specialization of E-class SEPALLATA genes in an early-diverging eudicot.
    Dev. Biol., 2016. 419(1): p. 143-155
    [PMID:27502434]
  13. Conn VM, et al.
    A circRNA from SEPALLATA3 regulates splicing of its cognate mRNA through R-loop formation.
    Nat Plants, 2017. 3: p. 17053
    [PMID:28418376]
  14. Käppel S,Melzer R,Rümpler F,Gafert C,Theißen G
    The floral homeotic protein SEPALLATA3 recognizes target DNA sequences by shape readout involving a conserved arginine residue in the MADS-domain.
    Plant J., 2018. 95(2): p. 341-357
    [PMID:29744943]