PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10578
Common NameKK1_010886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 346aa    MW: 38774.4 Da    PI: 6.4011
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10578genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.22.5e-06446440
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                   r C+ +++  + l+C+ ++  lC +C  e H+       Ht++
  C.cajan_10578  4 RPCDYCGHSTALLYCRADSAKLCFSCDREVHSTnqlfskHTRT 46
                   67******99*********************668888888876 PP

2zf-B_box24.94.2e-084887539
       zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.....Htv 39
                    C+ +++ ++++ C +  + lC++C  e+H+      H++
  C.cajan_10578 48 LCDACDHSPATILCSTEASVLCQNCDWETHNPslsslHQR 87
                   7*****************************5477777876 PP

3CCT64.43.4e-22300343144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R+ allRYk+K+ktR+F+K+irYesRK++Ae+R RvKGrF+k +
  C.cajan_10578 300 RDSALLRYKQKKKTRRFDKHIRYESRKVRAETRVRVKGRFAKMD 343
                    899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.068148IPR000315B-box-type zinc finger
SMARTSM003361.4E-12148IPR000315B-box-type zinc finger
PfamPF006433.5E-5446IPR000315B-box-type zinc finger
CDDcd000216.99E-7448No hitNo description
PROSITE profilePS501199.9834490IPR000315B-box-type zinc finger
PfamPF006431.6E-54887IPR000315B-box-type zinc finger
CDDcd000211.18E-44890No hitNo description
SMARTSM003360.0734990IPR000315B-box-type zinc finger
PfamPF062031.3E-16300342IPR010402CCT domain
PROSITE profilePS5101714.733300342IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTTRPCDYCG HSTALLYCRA DSAKLCFSCD REVHSTNQLF SKHTRTLLCD ACDHSPATIL  60
CSTEASVLCQ NCDWETHNPS LSSLHQRGPL EPFTGCPSVS ELLSILAFRD VTKKTLLSPP  120
HATPADASFS SEIEGFSDFF VWDAPSVVTI DDLISSSASS HTFQAMEVPP LPKNRKAACG  180
QHREEILSQL RELAKSEPLD LEQYVPSENL SSGFERDVEP DIFPSHEWHR ESTEPMYQVV  240
PPDTPLGTYT EEIPVKHSTS AVGETDTHGN HGGNPPISFK SEILPTTPRA AACELNSQER  300
DSALLRYKQK KKTRRFDKHI RYESRKVRAE TRVRVKGRFA KMDQEH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1308314QKKKTRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_10578
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020213698.10.0zinc finger protein CONSTANS-LIKE 13
RefseqXP_020213699.10.0zinc finger protein CONSTANS-LIKE 13
TrEMBLA0A151TX110.0A0A151TX11_CAJCA; Zinc finger protein CONSTANS-LIKE 13
STRINGGLYMA03G36810.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70553145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.15e-93B-box type zinc finger protein with CCT domain