PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10458
Common NameKK1_010760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 345aa    MW: 38588.1 Da    PI: 6.0529
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10458genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.15.8e-065697440
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                     C+ +++ +++  C++ ++ lC++C  ++H +      H+++
  C.cajan_10458 56 LLCDACGDSPASVLCFSEDSVLCHNCDCQSH-NlslspvHQRR 97
                   68*****************************.55788888765 PP

2CCT64.23.8e-22299342144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R+ allRY+eK+ktR+++K+irYesRK++AesR R+KGrFvk +
  C.cajan_10458 299 RDSALLRYREKKKTRRYDKHIRYESRKVRAESRMRIKGRFVKDE 342
                    899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.4561057IPR000315B-box-type zinc finger
SMARTSM003362.8E-101057IPR000315B-box-type zinc finger
CDDcd000216.21E-51357No hitNo description
PROSITE profilePS501199.35399IPR000315B-box-type zinc finger
CDDcd000215.53E-45786No hitNo description
SMARTSM003360.465899IPR000315B-box-type zinc finger
PROSITE profilePS5101714.991299341IPR010402CCT domain
PfamPF062031.1E-16299341IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
EEEDMSEAPQ LRRTCDYCGD LAALLYCRAD SARLCFFCDR KVHFPNQLFS KHARALLCDA  60
CGDSPASVLC FSEDSVLCHN CDCQSHNLSL SPVHQRRTLQ GFSGCPSGTQ LLGILGLTEK  120
SLLSAEGSSQ IEGLSDFHVW TDPSAVGLED LITDTASSHK NRKGACGRQK EEIVSQLREL  180
IKVEADLVHE EVDAEQQLQL GNLSTGFERD IDANVFPSYE AGVFCWHGES SDPTNQIVPS  240
DTPLRDFGEV VPDKHTSFTI PGTHANFNDQ GKPSNSFSAE NMSPAPPKAT PYELTSHERD  300
SALLRYREKK KTRRYDKHIR YESRKVRAES RMRIKGRFVK DETQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_10458
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150417e-38AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020213313.10.0zinc finger protein CONSTANS-LIKE 13
TrEMBLA0A151TWN70.0A0A151TWN7_CAJCA; Zinc finger protein CONSTANS-LIKE 13 (Fragment)
STRINGGLYMA10G02621.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70553145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.11e-70B-box type zinc finger protein with CCT domain