PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10290
Common NameKK1_010586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HB-other
Protein Properties Length: 946aa    MW: 105448 Da    PI: 9.0984
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10290genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.47.5e-0669125157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ +++ F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  C.cajan_10290  69 KRPRDLLNPKAVNYMQSIFSIKDAVSKKELREISALFGVTVTQVRDFFTSQRSRVRR 125
                    799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.63766126IPR001356Homeobox domain
SMARTSM003893.9E-468130IPR001356Homeobox domain
CDDcd000861.34E-469125No hitNo description
Gene3DG3DSA:1.10.10.601.7E-569135IPR009057Homeodomain-like
SuperFamilySSF466891.63E-669131IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.105.9E-4222313IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 946 aa     Download sequence    Send to blast
MDVWNEDFSE LEIGSSAESF QKFLVSQREL FHSQIDQFQE IVVTQCNLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSIFSIK DAVSKKELRE ISALFGVTVT QVRDFFTSQR  120
SRVRRIVQLS KERALSSNSC EEPHDDQINS DPARPIDPAP LNSVGLSNAE ESCSAQEAAL  180
SDLDDSDKQF VDNIFSLMQK EETFSGQEKL MEWILTIQNF SVLLWFLTKG GGMTLATWLS  240
NAAVEEQTTV LLLILKVLCH LPLHKAVPMH ISAILQSVNK LRFYRTSVSD ISNRARVLLS  300
KWSKLLARNQ AIKRPNGVNI GQFMGSESWH SNIDVPEDIL ALSNECSDNF RKVGSPQVMK  360
LLPSSLDDSN RKSTLGVSSS QSRERRKVQL VEQPGQKSAS RSSQVMRAGP VSQGRPMSAD  420
DIQKAKMRAL FMQSKYGKTG SSKDSKETKI DTSYSKPKMD VKEPLWEKCK RVQIPWKIPA  480
EVKLKDTWRV GRGENSKEVD VQKNRIRRER ETIYKTVQEM PPNPKEPWDL EMDYDDTLTP  540
EIPTEQLPDG DGAEIAVSPN QDATHAVQGV ASTSSTSLAT AEPDLELLAV LLKNPGLVFA  600
LTSGQAGSIP SEETVKLLDM IKRGGVSLGL SESTNGNYGT SVEAPEKVEV SLPSPTPSSD  660
PRTSGWSTEA SKNPFSRRSV APDRIIQNHA SVASTNLVSQ IPVTATTVRQ QATILVPSSR  720
QLSSTSVSPY SLPQATNVIP EKPPPLMHVQ TPSSDLGLTM KNNLITANAS SVKLSGTHST  780
LAMRGEGTNY VKPVPNLSVQ HEAPQQQRHH QQEAHYTEPS YRTPVHSYPP QTEKSDHGSD  840
TWRVRQQEVS SSYHSQRNHN NYNTMVGGSR QSGIWDRNNH GRGEFESWSP ENSPTRNPRY  900
APGRNYPESR MNHGRNHRPE WSRQRGSSGH WDPGRQGNRK WHDQRR
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_10290
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353490.0AC235349.1 Glycine max strain Williams 82 clone GM_WBb0092H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020211335.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-164LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A151TWD10.0A0A151TWD1_CAJCA; Homeobox protein LUMINIDEPENDENS
STRINGGLYMA03G36970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-153HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]