PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10204
Common NameKK1_010494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YC
Protein Properties Length: 227aa    MW: 25120.2 Da    PI: 6.8635
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10204genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC45.61.5e-1479116135
          NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkaded 35 
                    ql++fw++q   iek+tdfknh+lPlarikki+kaded
  C.cajan_10204  79 QLQQFWSNQyqeIEKVTDFKNHSLPLARIKKIMKADED 116
                    89******99999************************9 PP

2NF-YC42.41.5e-1311514967101
          NF-YC  67 eenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                    e+nkrrtl+k+diaaa+trtdifdflvdivpr++l
  C.cajan_10204 115 EDNKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 149
                    589*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.39E-1373140IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.3E-893116IPR009072Histone-fold
Gene3DG3DSA:1.10.20.109.3E-10117146IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MDHQGHSQNP SMGVVGSGAQ LAYGSNPYQP GQITGAPGSV VTSVGTIQST SQPAGAQLGQ  60
HQLAYQHIHQ QQQHQLQQQL QQFWSNQYQE IEKVTDFKNH SLPLARIKKI MKADEDNKRR  120
TLQKNDIAAA ITRTDIFDFL VDIVPREDLK DEVLASIPRG TMPVAGPADT LPYCYMPPQH  180
APQVGTGGVI MGKPVMDPNM YAQQSHPYIA PQMWPQPPDQ RQSSPEH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118124RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0926781e-151BT092678.1 Soybean clone JCVI-FLGm-16A14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604828.11e-138PREDICTED: nuclear transcription factor Y subunit C-3
RefseqXP_014627411.11e-138PREDICTED: nuclear transcription factor Y subunit C-3
SwissprotQ8L4B29e-53NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLA0A151TW301e-167A0A151TW30_CAJCA; Nuclear transcription factor Y subunit C-9
STRINGGLYMA19G42460.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.44e-50nuclear factor Y, subunit C9