PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09572
Common NameKK1_009841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 166aa    MW: 18883.6 Da    PI: 9.1848
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09572genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.5e-182579256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   rk+ +++k+q   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  C.cajan_09572 25 RKKLRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 79
                   778899***********************************************98 PP

2HD-ZIP_I/II127.84.5e-4125114191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  C.cajan_09572  25 RKKLRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKELQELR-AL 114
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-18975IPR009057Homeodomain-like
SuperFamilySSF466897.1E-191482IPR009057Homeodomain-like
PROSITE profilePS5007117.0382181IPR001356Homeobox domain
SMARTSM003895.6E-152385IPR001356Homeobox domain
PfamPF000462.3E-152579IPR001356Homeobox domain
CDDcd000866.09E-142582No hitNo description
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PfamPF021831.2E-1181115IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.3E-2581124IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MDFCVGNTTK SCDGASDDDE NGSTRKKLRL SKQQSAFLEE SFKEHTTLNP KQKLALAKQL  60
NLRPRQVEVW FQNRRARTKL KQTEVDCEYL KRCCESLTEE NRRLQKELQE LRALKTCQPF  120
YMQLPATTLT MCPSCERVAT NTTGAAATNK NNPAAALSID KPRILP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12329TRKKLRL
27381RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_09572
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311631e-134KT031163.1 Glycine max clone HN_CCL_195 homeodomain/HOMEOBOX transcription factor (Glyma03g30200.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520539.11e-93homeobox-leucine zipper protein HOX11
RefseqXP_028225408.11e-93homeobox-leucine zipper protein HOX11-like
SwissprotA2Z1U11e-79HOX11_ORYSI; Homeobox-leucine zipper protein HOX11
SwissprotP466652e-79HAT14_ARATH; Homeobox-leucine zipper protein HAT14
SwissprotQ67UE24e-79HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A151TU891e-118A0A151TU89_CAJCA; Homeobox-leucine zipper protein HOX11
STRINGGLYMA03G30200.14e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-66homeobox from Arabidopsis thaliana