PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09314
Common NameKK1_009578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31630.9 Da    PI: 9.1452
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09314genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.3e-20123176356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    k+ ++tk+q  +Le+ F+++++++ ++++eLAkkl+L  rqV vWFqNrRa+ k
  C.cajan_09314 123 KKLRLTKQQSAILEDSFKQHSTLTPKQKQELAKKLNLRPRQVEVWFQNRRARTK 176
                    56789***********************************************98 PP

2HD-ZIP_I/II113.71.1e-36122209188
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                    +kk+rl+k+q+++LE+sF+++++L+p++K+ela++L+l+prqv+vWFqnrRARtk+k++E+++e Lk+++++l+ee+++L+ke eeL+
  C.cajan_09314 122 NKKLRLTKQQSAILEDSFKQHSTLTPKQKQELAKKLNLRPRQVEVWFQNRRARTKLKETEVECELLKKWCESLREEKKMLQKELEELK 209
                    59************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-18116179IPR009057Homeodomain-like
PROSITE profilePS5007117.346118178IPR001356Homeobox domain
SMARTSM003897.4E-17120182IPR001356Homeobox domain
CDDcd000861.75E-17123179No hitNo description
PfamPF000462.5E-17123176IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-19127176IPR009057Homeodomain-like
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
SMARTSM003402.8E-10178224IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGFDISIPGL RLGLGLGLHD HDEHKQRRQR QKKKEADPCN KAYPSLTLGP PPDDDVEANN  60
NEPISKTESD EYYYFHPHAS SPSAVSSFSN SCIKRDRDQF AGEEVEKILS RVVDVHENGN  120
PNKKLRLTKQ QSAILEDSFK QHSTLTPKQK QELAKKLNLR PRQVEVWFQN RRARTKLKET  180
EVECELLKKW CESLREEKKM LQKELEELKL MKARVGVGPY YMQLPVASLT ICPSCDKIYG  240
GSGATKNGSS PTTPLLLGPK AHHSFYKSNY TFTQSSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12634RRQRQKKKE
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_09314
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020210781.10.0homeobox-leucine zipper protein HOX15
SwissprotA2XE763e-54HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL43e-54HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A151TTF70.0A0A151TTF7_CAJCA; Homeobox-leucine zipper protein HOX19
STRINGGLYMA04G05200.21e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-45homeobox from Arabidopsis thaliana