PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09230
Common NameKK1_009490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family ARR-B
Protein Properties Length: 665aa    MW: 73485.7 Da    PI: 6.4727
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09230genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.63.8e-25204255153
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                    kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQ +
  C.cajan_09230 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQAF 255
                    79*******************.*****************************87 PP

2Response_reg76.21.2e-25201281109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ + +l+++l++ +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + +  Ga
  C.cajan_09230  20 VLAVDDDPTCLLVLETLLRRCQY-HVTTTNQAITALALLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKGIAHGA 113
                    799********************.***************999889*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  C.cajan_09230 114 CDYLLKPVRMEELKN 128
                    ************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.6E-1601660IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.6E-4217141No hitNo description
SuperFamilySSF521721.71E-3617141IPR011006CheY-like superfamily
SMARTSM004484.2E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.32919134IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.5E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.14E-2721134No hitNo description
PROSITE profilePS5129411.783201260IPR017930Myb domain
SuperFamilySSF466893.05E-17201258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-25202257IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-24204258IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MTVDNRMNDS PDDFPVGMRV LAVDDDPTCL LVLETLLRRC QYHVTTTNQA ITALALLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIA HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKKKTSNL DKPTSDSGNG LGSSGAGNSE QNEKLTKKRK  180
DQDEDEDEEQ ENDQDNEDPS TQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQAFFLFSS PLLYLKRISC VANQQANMVA ALGGADASYL RMSSVSGVGH  300
LQTLSGSGQL QNNGFRSFPS SGIINRLNTP AGLNVHGFPS GVLQLSQSQN LNHNDHLKFQ  360
SAMVPVNQNG IQGMPMSVGL DQLQNNKGVI SVHFDAKTFP ILNKLSDPRP KVTTSGSHTP  420
DLGISNNALM VEPRLQGTQG SVRYETLSSS PASQNSEFSL SMLDQGRYSD NWSSAVQPSV  480
IQTNSYPPSE CFRRTNIRPT DNMASVPLQG GNLSGPSITS LSRQPHDSIT DMHSEGVIFT  540
NRPGLLSSNA PFQGWDDHSQ DATHHSNIMF GSINSLNPVN GAATDSNLHR NLDFSYCDPL  600
QMKHDGFVEL TEETSLKHQG NIMNQQKSQQ SGFSNNLGSL EDLVSSMMKQ VITFTQYTYI  660
LKFFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22200255156ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_09230
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0938360.0BT093836.1 Soybean clone JCVI-FLGm-24O12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020212720.10.0two-component response regulator ARR12 isoform X1
SwissprotQ6K8X61e-136ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A151TTG40.0A0A151TTG4_CAJCA; Two-component response regulator
STRINGGLYMA04G06650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-120response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]