PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_08743
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7129.43 Da    PI: 10.7426
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_08743genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF104.44e-33959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  C.cajan_08743  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                   79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-31260IPR002100Transcription factor, MADS-box
CDDcd002657.72E-39259No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-34323IPR002100Transcription factor, MADS-box
PfamPF003199.6E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG  60
PR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-20159159MEF2 CHIMERA
6byy_B1e-20159159MEF2 CHIMERA
6byy_C1e-20159159MEF2 CHIMERA
6byy_D1e-20159159MEF2 CHIMERA
6bz1_A1e-20159159MEF2 CHIMERA
6bz1_B1e-20159159MEF2 CHIMERA
6bz1_C1e-20159159MEF2 CHIMERA
6bz1_D1e-20159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_08743
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-81AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153483.12e-38hypothetical protein PHAVU_003G039400g
SwissprotP293835e-35AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBLV7C5L04e-37V7C5L0_PHAVU; Uncharacterized protein
STRINGXP_007153483.16e-38(Phaseolus vulgaris)
STRINGLus100178701e-36(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.31e-39MIKC_MADS family protein
Publications ? help Back to Top
  1. Maejima K, et al.
    Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen.
    Plant Signal Behav, 2015. 10(8): p. e1042635
    [PMID:26179462]